SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000009267 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000009267
Domain Number 1 Region: 101-423
Classification Level Classification E-value
Superfamily Terpenoid synthases 3.84e-81
Family Isoprenyl diphosphate synthases 0.0000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000009267   Gene: ENSLOCG00000007637   Transcript: ENSLOCT00000009278
Sequence length 424
Comment pep:known_by_projection chromosome:LepOcu1:LG9:16093230:16103132:-1 gene:ENSLOCG00000007637 transcript:ENSLOCT00000009278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPWRRCCRWTAGLGGAPLLSAVCGRFAAVAEGSLRRKGTSSGLGSAAAAFAAGAGNKV
QCRSQSAVIKKPSVWWRCNFRSLCTTENPRCCNRLHSDANLKDPFPLVQKDLKNLYDDIK
KELLVSKLELKSLCDYYFDGKGKAFRPMVVALMARACNVHSGRDRDLLPCQRSIAMISEM
IHTASLVHDDVIDGSDTRRGKTTINEIWGERKAILAGDFILSKASMALARIGNNTVVAVL
SQVIDDLVRGEFMQLGSKENENERFKHYLEKTFKKTASLIANSCKAVSILGSPDPEVHEI
AFQYGKNIGIAFQLIDDVLDFTSCANQLGKPSAADLRLGLATGPVLFACQQFPELHAMIM
RRFGSAGDVERAWQYVLQSDGVQQTSYLAHRYCQEAIQQIRKLCPSPEREALVHLPEIIL
TRDK
Download sequence
Identical sequences W5MLK8
XP_015209486.1.81211 ENSLOCP00000009267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]