SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000009288 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000009288
Domain Number 1 Region: 87-409
Classification Level Classification E-value
Superfamily Terpenoid synthases 3.52e-81
Family Isoprenyl diphosphate synthases 0.0000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000009288   Gene: ENSLOCG00000007637   Transcript: ENSLOCT00000009299
Sequence length 410
Comment pep:known_by_projection chromosome:LepOcu1:LG9:16093230:16103132:-1 gene:ENSLOCG00000007637 transcript:ENSLOCT00000009299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPWRRCCRWTAGLGGAPLLSAVCGRFAAVAEGSLRRKGTSSGLGSAAAAFAAGAGNKS
STKCNFRSLCTTENPRCCNRLHSDANLKDPFPLVQKDLKNLYDDIKKELLVSKLELKSLC
DYYFDGKGKAFRPMVVALMARACNVHSGRDRDLLPCQRSIAMISEMIHTASLVHDDVIDG
SDTRRGKTTINEIWGERKAILAGDFILSKASMALARIGNNTVVAVLSQVIDDLVRGEFMQ
LGSKENENERFKHYLEKTFKKTASLIANSCKAVSILGSPDPEVHEIAFQYGKNIGIAFQL
IDDVLDFTSCANQLGKPSAADLRLGLATGPVLFACQQFPELHAMIMRRFGSAGDVERAWQ
YVLQSDGVQQTSYLAHRYCQEAIQQIRKLCPSPEREALVHLPEIILTRDK
Download sequence
Identical sequences W5MLM9
ENSLOCP00000009288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]