SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010013 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010013
Domain Number 1 Region: 216-416
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.79e-58
Family Reprolysin-like 0.0000807
Further Details:      
 
Domain Number 2 Region: 433-508
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.45e-21
Family Blood coagulation inhibitor (disintegrin) 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000010013
Domain Number - Region: 546-589
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00772
Family Pentapeptide repeats 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010013   Gene: ENSLOCG00000008238   Transcript: ENSLOCT00000010025
Sequence length 824
Comment pep:known_by_projection chromosome:LepOcu1:LG5:14808721:14826273:-1 gene:ENSLOCG00000008238 transcript:ENSLOCT00000010025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLERSLFLFSFFICFINRSQATDLFAEQTSKLSSYRVVIPRVVHDREKRDTLQPQGSEQA
PDADRLMYSINIEDKDHVLHLEKNKDFLAKTFVHYSYDDSGKLATSHPKEEDHCYYHGYV
EGQDDSLVALSTCSGLSGIILMGQKTYGLEPVIRSSANEHLLFLLEHSQKDPFVCGVTNE
MPPFEINTESHSQHYQGHTDTVESMTRMFRKKRNLPQTRYVELILVADKQMYDDRNANET
ALQKDMVQMANLLDGYYKQLNVRVILVGVEIWNNQNPIDVDGSAGEVLGRFVQWRKNVLI
PKKKHDVGQLIVGRKTSYPQGVLGMAFVGTVCSVSSAGGINVFGGSTLQFVSTVIAHEMG
HNLGMNHDDKRNCNCAVKSCIMNSGASGSTTFSSCSGTDFENLILQGRGICLKNQPSSLD
IFSVAGCGNGVLDQGEQCDCGKPEDCQDKCCDAATCTFTRGSYCSQGSCCDNCQLKVAGT
PCRESVNICDLPEYCIGTSPFCPNDYYIMDGYPCENNTAYCYEGRCQTYDYQCQKLFTKD
ANKAPNICFEDANTRGDRFGNCGMTGTIFNRCTVENALCGKIQCSGVDVTNPPFGSTITV
KNIGNTQCVNVDFDLGSDVLDPGYVSRGSGCSQGKACVDFKCTNASELNFNCDIQTKCSG
NGVCNNQGNCHCNAGWAPPDCSRKGSGGSIDSGPTTIDTSVRDGLLIFFLLVVPIIIIVL
VLLFLFKRGWKPQCLREKRSRQYRSRNSAPTNAQRAAPQSQPQSHTGPPQPATIYPPRSS
DLPPSRKDVSFSLPQYQPSETPLPVHQQGPGVPRPIPPAQPQQS
Download sequence
Identical sequences W5MNQ4
XP_015202031.1.81211 ENSLOCP00000010013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]