SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010025 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010025
Domain Number 1 Region: 214-414
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.69e-58
Family Reprolysin-like 0.0000807
Further Details:      
 
Domain Number 2 Region: 431-506
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.32e-21
Family Blood coagulation inhibitor (disintegrin) 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000010025
Domain Number - Region: 544-589
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00746
Family Pentapeptide repeats 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010025   Gene: ENSLOCG00000008238   Transcript: ENSLOCT00000010037
Sequence length 803
Comment pep:known_by_projection chromosome:LepOcu1:LG5:14811230:14824685:-1 gene:ENSLOCG00000008238 transcript:ENSLOCT00000010037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFVYLNCLVSFGLLDHFILPVEVNKQTSKLSSYRVVIPRVVHDREKRDTLQPQGSEQAPD
ADRLMYSINIEDKDHVLHLEKNKDFLAKTFVHYSYDDSGKLATSHPKEEDHCYYHGYVEG
QDDSLVALSTCSGLSGIILMGQKTYGLEPVIRSSANEHLLFLLEHSQKDPFVCGVTNEMP
PFEINTESHSQHYQGHTDTVESMTRMFRKKRNLPQTRYVELILVADKQMYDDRNANETAL
QKDMVQMANLLDGYYKQLNVRVILVGVEIWNNQNPIDVDGSAGEVLGRFVQWRKNVLIPK
KKHDVGQLIVGRKTSYPQGVLGMAFVGTVCSVSSAGGINVFGGSTLQFVSTVIAHEMGHN
LGMNHDDKRNCNCAVKSCIMNSGASGSTTFSSCSGTDFENLILQGRGICLKNQPSSLDIF
SVAGCGNGVLDQGEQCDCGKPEDCQDKCCDAATCTFTRGSYCSQGSCCDNCQLKVAGTPC
RESVNICDLPEYCIGTSPFCPNDYYIMDGYPCENNTAYCYEGRCQTYDYQCQKLFTKDAN
KAPNICFEDANTRGDRFGNCGMTGTIFNRCTVENALCGKIQCSGVDVTNPPFGSTITVKN
IGNTQCVNVDFDLGSDVLDPGYVSRGSGCSQGKACVDFKCTNASELNFNCDIQTKCSGNG
VCNNQGNCHCNAGWAPPDCSRKGSGGSIDSGPTTIDTSVRDGLLIFFLLVVPIIIIVLVL
LFLFKRGWKPQCLREKRSRQYRSRNSAPTNAQRAAPQSQPQSHTGPPQVPILPQYQPSET
PLPVHQQGPGVPRPIPPAQPQQS
Download sequence
Identical sequences W5MNR6
ENSLOCP00000010025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]