SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010031 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010031
Domain Number 1 Region: 77-252
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.15e-42
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 227-348
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.02e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010031   Gene: ENSLOCG00000008261   Transcript: ENSLOCT00000010043
Sequence length 481
Comment pep:known_by_projection chromosome:LepOcu1:LG20:13874129:13910328:1 gene:ENSLOCG00000008261 transcript:ENSLOCT00000010043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTENGLRSSDPQNLRGTSESLAERESSSFGSDSEVNGFANTERQTDRYGFIGGAQQHT
GHSEQEVPPEVLRQREAKWLDMLNNWDKWMAKRHKKVKLRCQKGIPPSLRGRAWLYLSGG
KVKKEQNQRKFQELDSQPGDPKWLDVIEKDLHRQFPFHEMFVARGGHGQQDLFRVLKAYT
LYRPEEGYCQAQAPIAAVLLMHMPAEDAFWGLVQICEKYLPGYYSAGLEAIQLDGEILFA
LLRRVSPAAHKHLKKHKIDPILYMTEWFMCAFSRTLPWASVLRVWDMFFCEGVKIIFRVG
LVLLKCMLGTQEKLKACQGQYETMELLRAVDPKYMLEGFLIREILELPVSERDIEKEHHV
QLKRWKETHGDLHYKSPPRMHGARAIITAEPHTRQDLRQNPTIVVEPPPPNAPPAKDEKK
KDKGRRGSLKKAPGSKKEVANPYPIPSVPPSLPADAPLQPEPESSQQDNQSLSSTELDTY
L
Download sequence
Identical sequences W5MNS2
XP_006640524.1.81211 ENSLOCP00000010031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]