SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010051 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010051
Domain Number 1 Region: 57-330
Classification Level Classification E-value
Superfamily Terpenoid synthases 4.17e-64
Family Aristolochene/pentalenene synthase 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010051   Gene: ENSLOCG00000008276   Transcript: ENSLOCT00000010063
Sequence length 332
Comment pep:known_by_projection chromosome:LepOcu1:LG11:25581634:25599553:1 gene:ENSLOCG00000008276 transcript:ENSLOCT00000010063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAACICSRSGFPAFRRSSFPCHGKVFSPSVHLVPRFTVPECSTVFRESSSGQSQHSEKYC
LDLVRVRDYEGFICSLLMPVALRRSSIALRAFNVELAQVKDAVSQKTIGLMRMQFWKNAV
EEIFRDEPPHQPVTAELWRAVKKHSLTKRWLLRIIKEREKDLDDRAYRSLPELESYSENT
QSSLLYLLLESLGVKDVHADHAASHIGKAQGIVTCLRATPYHSRRRRVYLPMDICMLHGV
SQEDFIRGSGEQKVRDVVFDIASQAHVHLHHARSFSKNVPLNASPAFLQTVALEDYLERV
RRVDFDVFHPSLQKRNPLLPLQLYIKSWKRTY
Download sequence
Identical sequences W5MNU2
ENSLOCP00000010051 XP_015213196.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]