SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010069 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010069
Domain Number 1 Region: 222-287
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-22
Family Ypt/Rab-GAP domain of gyp1p 0.003
Further Details:      
 
Domain Number 2 Region: 61-120
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000732
Family Ypt/Rab-GAP domain of gyp1p 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010069   Gene: ENSLOCG00000008291   Transcript: ENSLOCT00000010081
Sequence length 457
Comment pep:known_by_projection chromosome:LepOcu1:LG9:17677104:17698041:1 gene:ENSLOCG00000008291 transcript:ENSLOCT00000010081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENVSAPTDPDCDSGSGSDAISQLSTGVPARETDRFGFILGTGLSSDCEGPPPEVIRQRE
VKWLEIISHWDRFLLKKSSKVKSQCRKGIPPSLRARCWPLLCAATAKMSTYNKIYEHAFC
DSPHYTSSISVKERDTDDKLFTSLSSGKDAHTWDGLFSAVKLMNSSCFTRLTRLVCVSTP
EICIHWFAHSLCLALTFCVNTIKMIECFPNGGGDTAIPLSLQEGVLFDSRLFSSVLRRAC
PVADKHLRKHGVEPLMYLTDWFMCLYTRNLPFNTLLRVWDIFFSEGAESEADFQSVKENQ
SRDTANQREAGQESLCVQGQEGLQSQSESDVGTDVMDLRGTEADVLTPETNLTLPEPSCD
SEVNPLPTTQEQSEPRDPKTRREREEEKARKKREKEMEKERQRLERDRERERRKPQTRGK
SFQVHSKCSHNMPPPGNKTTDNLVSKRNSAPYFDTYF
Download sequence
Identical sequences W5MNW0
ENSLOCP00000010069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]