SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010127 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010127
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.54e-36
Family GABARAP-like 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010127   Gene: ENSLOCG00000008340   Transcript: ENSLOCT00000010139
Sequence length 117
Comment pep:known_by_projection chromosome:LepOcu1:LG26:13615443:13617229:1 gene:ENSLOCG00000008340 transcript:ENSLOCT00000010139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRYQRSVPLPVRRAEGQRIREKHPDKIPIIVERVARARVPDLQKKKYLVPSDLTVGQF
CFLIRQRISLRPEEALFFFVDNALPPSGATLAQIYQDHHAEDLFLYVAYSDESVYGA
Download sequence
Identical sequences W5MP18
ENSLOCP00000010127 XP_006642471.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]