SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010997 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010997
Domain Number 1 Region: 150-375,419-469
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.96e-49
Family Glycerol-3-phosphate transporter 0.051
Further Details:      
 
Domain Number 2 Region: 587-732
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.35e-19
Family Glycerol-3-phosphate transporter 0.02
Further Details:      
 
Domain Number 3 Region: 492-573
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000105
Family Pentapeptide repeats 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010997   Gene: ENSLOCG00000009018   Transcript: ENSLOCT00000011013
Sequence length 735
Comment pep:known_by_projection chromosome:LepOcu1:LG24:9145724:9198137:-1 gene:ENSLOCG00000009018 transcript:ENSLOCT00000011013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDGYRDRTAFIRGAKDIAKEVKRQAAKKVGRSVDKVADEYTKRSYSRFEEDDDDDYPQP
QDGYYRSDSRHNEDEGANSDSTEGHDEDDEIYEGEYQGIPRAESGKADGLGGPQAEGLAA
TGAQFRDFGELAGERRKDREELAQQYETILQECGHGRFQWTLYFVLGLALMADGVEIFVV
GFVLPSAEKDMCLSEPNKGMLGLIVYLGMMVGAFLWGGLADRIGRRQCLLISLSINSVFA
FFSSFVQGYSTFLLCRLLSGVGIGGSIPIVFSYYSEFLAQEKRGEHLSWLCMFWMIGGIY
ASAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIAALTTMPESPRFFLENGK
HDEAWMVLKQVHDTNMRAKGYPERVFSVTNIKTVKQLDELVEIGADTGAWHRRWRMRLTS
LFHQVWGNFLACFSPEYRRTTLMMMAVWFTMSFSYYGLTVWFPDMIKYMQKQDYAMRTKL
FSREKVEHFTFNFTLENQIHRNGEFFNNKFINMKMKSMVFEDSLFEECYFEDITSSNTFF
RNCTFINTLFYNTDLFKYRFVNSRLLNSTFLHNKEGCMLDFSDDNNAYMIYFVSFLGTLA
VLPGNIVSALLMDKIGRLRMLAGSSVMSCISCFFLWFGSNESAMIALLCLFGGISIASWN
ALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAVPIMFASGALAAGS
FLALKLPETRGQVLQ
Download sequence
Identical sequences W5MRI8
XP_006641841.1.81211 XP_015192159.1.81211 ENSLOCP00000010997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]