SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000011100 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000011100
Domain Number 1 Region: 527-691
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-43
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 666-790
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.37e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0071
Further Details:      
 
Domain Number 3 Region: 130-260
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-20
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000011100   Gene: ENSLOCG00000009098   Transcript: ENSLOCT00000011116
Sequence length 1052
Comment pep:known_by_projection chromosome:LepOcu1:LG10:20291077:20652699:1 gene:ENSLOCG00000009098 transcript:ENSLOCT00000011116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDCSSLTKVSSTTDSVSTLNSEDIVLVAQQAEKSPSGRERKTGFKMSYSASKQLEKATE
ELLEDQAGNDDVKVEHPTSSKEKPATPINKVPPFTLQNFKLECFTDINPQVHPSTDVPAG
DSDSSAFPEEDSVLFNKLSYLGSMMVRVPRSEAEAQKAMASLKAEKHVPVLVTLYVPNVP
EGSVRIIEQASGTEIAAFPIYKVLFCARGRDGTPESDCFAFTESYRSCEDFQIHVFSCEI
KEAVSRILYSFSTAFRRSSKPAPDVKDSSLPTPESDIFTFTVSLEVKEDDGKGNFSPVPK
DRDKFYFKLRQGIEKKVMVTIQQITNKELGIERCFGMLLSPGQKVRNSDMHLLDMESMGK
SADGKGYVITGTWSPNIPAFQVLNEETPKDKQVYMTVAVDLVVTEVVEPVRFLLETLVRV
YPANERFWYFSRKTFTETFCLKLKQDSEKSSQSLGDMIYEVLSLKRQTHRNQTPQSPTGG
QGTPISPTEEEETEEDSDSEISSGTGDVSKDCPEKILESWGAILSRWHGNLGVRPKGLST
LVKPGIPEALRAEVWQLLAGCHNNQGLLETYRILITKESPQDGVITRDIHRTFPAHDYFK
DSDGDGQDSLYKICKAYSVYDEDIGYCQGQSFLAAVLLLHMPEEQAFCVLVKIMYEYGLR
QLYKNNFEDLHCKFYQLERLMQEQIPDLHSHFMGIGLEVHMYASQWFLTLFTAKFPLCMV
FHITDLLLYEGMNIIFNVALALLKTSKEDLLQADFEGALKFFRVQLPKRYRAAENARRLM
EQACNIKVPTKKLKKYEKEYQSMRENQLQQEDPIDRYQRENRRLQEASMRLEQENDDLAH
ELVTSKIALRNDLDQAEDKADVLNKELLNTKQRLVVMEDEKRRQEEETAQLKEVFRTELE
KAESEIKKTTVIISEYKQICSQLSTRLEKQQAVTKEELDIVKSKVMACERCREIFSKEGS
LQLPAISRDNRDQDVDEEKDSLKKQLRELELELAQTKLQLVEAKCKIQELEHQRGALMNE
IQAAKNSWFSKTLNSIKTATGNQPPPSPKEGV
Download sequence
Identical sequences W5MRU1
ENSLOCP00000011100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]