SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000011106 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000011106
Domain Number 1 Region: 489-661
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.25e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0037
Further Details:      
 
Domain Number 2 Region: 643-739
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.94e-19
Family Ypt/Rab-GAP domain of gyp1p 0.025
Further Details:      
 
Domain Number 3 Region: 808-934
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000663
Family Calmodulin-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000011106   Gene: ENSLOCG00000009091   Transcript: ENSLOCT00000011122
Sequence length 1240
Comment pep:known_by_projection chromosome:LepOcu1:LG4:25189440:25232166:1 gene:ENSLOCG00000009091 transcript:ENSLOCT00000011122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVNPEEVLLASALWITERANPYFILQKRKGHGGGGGGGGGLAGLLVGTLDVVLDSSARV
APYRILYQTPDSLVYWTIAHGGSRKEITEHWEWLEQNLLQTLSIFENENDITTFVKGKIQ
GIIAEYNKNHDIREDDDTEKFKEATAKFRKLFGMPEEEKLVNYYSCSYWKGKVPRQGWVY
LSINHLCFYSFLLGKEAKLVIRWADITQLEKNPTLLLPDIIKVSTRSNEHIFSVFLNINE
TFKLMEQLANIAMRQLLDNKGFEQDRSLPKLKKKSPKKVSALKRDLDARAKSERYRALFR
LPKDEKLDGHTDCTLWTPFNKMHIVGQMFVSTNYICFTSKEETLCSLIIPLREVTIVEKA
DSSSVLPSPLSISTKNRMTFLFANLKDRDFLVQRISDFLQQTTSKIYFDREIMGSYNSSD
DEVYSRQSSLLSCSPQRSLGSEIEGERQFNLNDNSVPTATQALMTMYRRRSPEEFNPKLA
KEFLKEQAWKNHFTEYGQGVCMYRTEKTKDLVLKGIPENMRGELWLLFSGAINEMATHPG
YYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYC
QAMNIVTSVLLLYAKEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELAREYVPQL
YDCMQDLGVISTISLSWFLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLALAVLDANIDK
LLNCKDDGEAMTVLGRYLDSVSNKDSTLPPIPHLHSLLTDDGEPHPEVDIFKLVRSSYEK
FGTIRADVIEQMRFKQRLRVIQTIEDTTKRNVVRTIVTETAFSIDELEELYVLFKAEHLT
SCYWGGNSNPTDRHDPSLPYLEQYRIDFEQFKGLFGLLFPWACGAHSDSLAMRFFRLLDQ
NGDSFINFREFVTGLSVLCHGDLTEKLKLLYKMHVLPEPAHEQEEPDSAFEATQYFFEDI
TPETSLGLDPKSKNDKDDGFVTVTFKTEKVKKTHTPDYRTYLRLWNQESKSKLENMKELP
KLNQGQFIELCKTLYNMFSEDPNEQDLYHATATVTSLLLEIGEVGKLFCSPAGGEDNSMT
TQGEGEAKFCSSGACGEQPLCSQMEDIKLEDSSPKDIGMSSAMLISDDETKDDTSMSSYS
VLSAGSHEMEEKLQCEDIADDTVLVRSNHGNSLPHSTSIDKDWAITFEQFLASVLTEQAL
VIYFEKPVEIVARISNAKNIRKVGRQIISASDYEISTLSG
Download sequence
Identical sequences W5MRU7
ENSLOCP00000011106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]