SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000011284 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000011284
Domain Number 1 Region: 48-337
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.46e-40
Family WD40-repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 545-654
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000000445
Family Ypt/Rab-GAP domain of gyp1p 0.025
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000011284
Domain Number - Region: 425-561
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0238
Family Ypt/Rab-GAP domain of gyp1p 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000011284   Gene: ENSLOCG00000009250   Transcript: ENSLOCT00000011300
Sequence length 1089
Comment pep:known_by_projection chromosome:LepOcu1:LG11:30952310:30973761:1 gene:ENSLOCG00000009250 transcript:ENSLOCT00000011300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTTDIGTKECGKIWYRKPTPSPSDGVLIRVVRSAAGYHSKTVRFLQAAFDTTGEAFLAG
DHHGNTYVFDISRNRFRLVQKTGQACTALAFNLRRKTEYLVALADYSIKCFDTDSKELVS
WMRGHESAVSSVSVHGSGRYAITTSADTAQLWDLDTFQRKRKLNVRQSVGIQKVFFLPLS
NTILSCFKDDSIFAWESDTLYCKYQLPVPEEGPRLHYKAFAVTRDGRTLVAGGKSNLLHL
WCLENRQLLRIIQMPPKVRTVRHLEFLPDSFDGGSSQILGVLSQDGIMRFINVQTCKLTF
DIGSHDDGISSAAISPNGHHIVAVMENGSLNIYSVESLTQDINKPPPPLVKVISGFERGS
GVSKDAGLRMQVKSEHVQRPVRSAGGKTQTRVLRPPADPTPEDKENELPDGLSRKRLQAL
LKEFGEYPAKYRMFIWRSLLRLPENHAAFSSLAAKGPHSAFLRLHEHYPIKSQKLQRVLQ
RVLSALAHWSAIFGETQYLPLVAFPFVKLFQNNQLICFEVIATVIMNWCQHWFEYFPNPP
LNVLCMVENVLAQHDKELLQHLVNCGVTSQLYAWPLLETLFSEVLTREEWLQLFDNVFSN
HPSFLLLAVVAYITCCRSPLLHCTLTEDFEYFFHHRNNLDISAMIKETYRLMDSTPAELH
PRHMLCDFEALTKGQYPVFNKYPTFIVEYQSQERERIRQQEMEYLRERQMAQELRSEAVR
RQAEDEAWHRQQELLQEAEEHRRRMLLEEESKLAEQRARLVAMKRELKTKELHLIDAARR
RFIKYQQDQKKMELRRLDDEINRKASMREQETATVLQDIEVRQMELEAQRRLFEQQLAKE
QERVNQEVKGEVDTHRRKAEAEDHAFQKLVDAEKDQDLETKRVLEESWAEADQLCTELGW
QAEVRRRLEQADAERGRCHLELARLNRETRAEEVQLLQLMKEMEGKRWEDVVERRAQLEE
EKQAAASAEAQRKAFLTAEKEEAEHLADSLRQSQEESLERLRELRVRSPCSVRGLLPKPN
TDQSEPRNTCLNILSSDDSSTHFSLDRGRSDLESRERELMLDVQELRQKIAAQARNTKPP
DRSSKISFS
Download sequence
Identical sequences W5MSC5
ENSLOCP00000011284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]