SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000012053 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000012053
Domain Number 1 Region: 50-222
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.63e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0068
Further Details:      
 
Domain Number 2 Region: 201-317
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000012053   Gene: ENSLOCG00000009858   Transcript: ENSLOCT00000012074
Sequence length 344
Comment pep:known_by_projection chromosome:LepOcu1:LG17:27345320:27370278:-1 gene:ENSLOCG00000009858 transcript:ENSLOCT00000012074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGEADRSRTTAKDRVQRIDPYGFERSEDFDYDSYEEFMSTYLQILTRRSIKWSKLLQGKS
NVERNLKVKRYVRKGIPNEHRSLIWMTASGAQEQMEKNPGYYRKLLEAEHDAKLVDTIKT
DLNRTFPDNIQFRKTAEPCLQHALFNVLVAYGHHNKNVGYCQGMNFITGYLIIVTKDEEK
SFWLLEALLGRILPDYYTPAMLGLKTDQEVLGELVRLKVPAVSQIMVQHNVMWTLVVSRW
FICLFIDILPVETVLRIWDCMFYEGSKIIFRVALTLIKHNQALILQGKNFPDICDKFKEI
IHGAFVEDCHAFMQKIFTEPGSLSMTTVNKLREMCRARILSQEQ
Download sequence
Identical sequences W5MUJ4
ENSLOCP00000012053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]