SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000012441 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000012441
Domain Number 1 Region: 387-582
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0024
Further Details:      
 
Domain Number 2 Region: 558-668
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-26
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000012441   Gene: ENSLOCG00000010162   Transcript: ENSLOCT00000012462
Sequence length 704
Comment pep:known_by_projection chromosome:LepOcu1:LG4:36898234:36953644:1 gene:ENSLOCG00000010162 transcript:ENSLOCT00000012462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGLSGTAVMDGSNGTNNCPTEMGVQAIVPAGSDIQDHENCKARMPCSHSLPSYKPNLHFT
GHREEDRQSLASQDSGIPTLEISNPEPIHCSGVNAKPNHSNGGFVYDPVLLGSGIMPVES
QGPATLNLESESSMKKSSTFPRSGYDTVKLFSPSSRALNRSDDISVCSVSSLSTEMSTTL
SVSNEDILDFMVTSDSSAIVNLETDEANFTDVTLSSPQDLGSGSPHCQQGFPPQEEPRQR
KLGPLASFFTRSLFAKKLKETRPLEQSEPGWKLFGKVPLREGSVKDPKKVQKEYEARSGR
PHNPPSPKQSVRKNLDFEPLSTTALILEDRPANLPAKPAEEAQKHRQQYEEMVAQAKKRE
MKEAQKRKKQLEERCKLEESITNAALTWNQEILPNWETMCGARKVREMWWQGVPPSVRGK
VWSLAVGNELNITHELYNICLARAKEKWKSLPASVPESENGDTASSLADREASLELIKLD
ISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIA
FANLLNKPCQMAFFRVDHSLMLTYFAAFEVFFEENLPKLFAHFKQNNLTPDIYLIDWIFT
LYSKSLPLDLACRVWDVFCRDGDEFLFRTALGILKLYEDILTKMDFIHNAQFLTKLPEDI
SPDELFIAIASIQMQSRNKKWTQVLQALQKDYREQERGSPVLKR
Download sequence
Identical sequences W5MVN2
ENSLOCP00000012441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]