SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000012611 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000012611
Domain Number 1 Region: 400-603
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.69e-62
Family Nucleotide and nucleoside kinases 0.00012
Further Details:      
 
Domain Number 2 Region: 199-311
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-24
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 128-217
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-20
Family PDZ domain 0.002
Further Details:      
 
Domain Number 4 Region: 68-117
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000494
Family L27 domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000012611   Gene: ENSLOCG00000010293   Transcript: ENSLOCT00000012635
Sequence length 612
Comment pep:known_by_projection chromosome:LepOcu1:LG12:26790874:26820800:1 gene:ENSLOCG00000010293 transcript:ENSLOCT00000012635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IALCPLGLSEILTNVVEEVKVSISRDINGADILYSLLNAPWLQSLLKVYECLQQYLQRNP
SPFLPYASGLSQEVMSDLRMSASSPDARELLILLRNPHMQAVLSAHDTVAQKDFEPVLPP
LPDNIPEEEEAMRIVCLVKNKQPLGATIKRNEITGEIVVARVIHGGLADRSGLLYAGDKL
VEVNGHSVEGLEPEQIIQILAQSHGTIVFKLVPISERPVNSQTMMYVRAMTDYSPQQDPA
IPCADAGMAFRKGDILEIVDQTDFLWWQARKLPNTSCCAGLIPSANLLKRRKQREFWWSQ
PLQPHTCVKISPELTHKFKEDMMAIDEKCVETEELREEEDGFSALNQGLYLAGFRRSLRL
CRRKSRSSHQQSCYARCPSSCYSALASPYEEVVRYQRHPEDRHRLIVLIGPSGVGVNELR
RRLIEINPKIFQGAVPHTTRPPKSYEENGREYHFVTKELFENMIHSNRFLEYGEYKGHLY
GTSIDSVKEVLENGKICIIDLEPQGIQGVRTHELKAYIIFIKPSSIIRMKQTRKSARIIT
DYYVNRPFKEEDFQEMEEMAKKVEAQYCQFFDHVIVNDSLQDSCVQLLTAVRRAQDEPQW
VPALWLRPAEES
Download sequence
Identical sequences W5MW52
ENSLOCP00000012611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]