SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000012702 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000012702
Domain Number 1 Region: 30-194
Classification Level Classification E-value
Superfamily RUN domain-like 5.49e-29
Family RUN domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000012702   Gene: ENSLOCG00000010363   Transcript: ENSLOCT00000012726
Sequence length 458
Comment pep:known_by_projection chromosome:LepOcu1:LG11:35230610:35272582:-1 gene:ENSLOCG00000010363 transcript:ENSLOCT00000012726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRRRKLEMASLSLGLNLSRKKGASRNGAVERKNLITVCRFSVKTLIDRSCFDTIDDSSS
EFVNFVSILEQILSHRLKGQITWFGYESPRGFWDYIRVACGRVPHNCLSSIESMENVRSS
RAKFETWRNQMYIYENLLFSIFLTSSLKLIKILSRRFYEDGAIVLGEEANLLADMLIGLN
AIDFSFCLKGEGIDDNRPAIIDYTPYLKFTQSSDSISSDEEELRTLGSSGSESSTPENMG
PALFMDQSSWYNKCKRVEQKYRLALEQKGYLEELVRLREAQLSESVSQNKILLQRLEETD
ISHKLEKEQLEYIVLELQDQLTVLKNHDLRSRQELTAHLTNQWPSPGALDTKAVALDTLA
YRKHTRQWKEKSFRSLEQLSAEISLSQTSLDPAHIQDLDSKQDESHSQSEGKEDTPSLLG
LCGSLTSVASYKSLASLKSSECLASPITEMTSPGFTPL
Download sequence
Identical sequences W5MWE3
ENSLOCP00000012702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]