SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000012980 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000012980
Domain Number 1 Region: 475-649
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.62e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0043
Further Details:      
 
Domain Number 2 Region: 627-726
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000000000837
Family Ypt/Rab-GAP domain of gyp1p 0.036
Further Details:      
 
Domain Number 3 Region: 795-922
Classification Level Classification E-value
Superfamily EF-hand 0.00000197
Family Calmodulin-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000012980   Gene: ENSLOCG00000010590   Transcript: ENSLOCT00000013007
Sequence length 1125
Comment pep:known_by_projection chromosome:LepOcu1:LG17:29607063:29626275:-1 gene:ENSLOCG00000010590 transcript:ENSLOCT00000013007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLNPEEVLLKNALKLWVTQKSNTYFLLQRRRGHGDGGGKLTGRGEAPVCFQDGGRADRL
GRIISRNEEISCLHVDAVLYVLHGQNVREEKFTFHDSSEFILNGKETVAQSIKGTCKNVQ
ADEQRSMLRSSVLGVFHRRASEFKGLGSLPKTSSLQSPSPSCPCWGVLLQKKGLEQLGVS
GVCTFSNIVLLWGKKMKMVIPWADVTKLERATSSFMTDTVRVTTRSRQRDFSMFLNLEEA
FQMMVQLADITLRRLLDNEVFELDQALQQPAHITKSRVLEEHAQKEYFLALFRLPRRERL
HEAAECSVWTPYSRRHTAGTLHASDSYVCFSGREEGSCTLLIPLAEVVTIEKAESTSFLP
NPIIISIRSKKAFQFIEVRERDELVESMTKRLRSVQWRRGVFRNKENHRKTQITPALYYT
FCYDKMYSDCENAEPSKKQSKPLLSTEALMSAFHHKLPEPSNSTSTMEQAKERLWQDHFS
EYGRGVYMFRTEKIQKLVAMGIPESMRGELWLTFSDAASDLASHPGYYAALVEESMGRCS
LVTEEIERDLHRSLPEHPAFQNDTGIAALRRVLTAYAHRNPKIGYCQSMNILASVLLLYS
KEEEAFWLLVAVCERMLPDYFNHRVIGAQVDQSVFEELIRERLPALAEHIPDLAPLSSVS
LSWFLTLFLSIMPFESAVNVVDCFFFDGIKAVFQLGLAVLDATAASLCNSTDDGQVLMIL
TSFLDHVRNEESSWPSVRNQASCEGSDRDSTEDTQIVDLVRDSHEKFGDLTVRQIEQLRR
RHRVQVLQAHEDTTKENVLRVVTQRVSLSAEELGDVYDLFKAQHFISCYWGGPGPGPGLQ
RHDPSRQYAEQYRVDRPQFKSLYQLLSPWPCGLHTDTVAHRTFALLDGDGDALINFGQFA
GWLDTVYCEELNEKIRLLYRLHIPPALTENEDEPSPLKTPLLSTTRPLYVELPNGEMKDY
QAQLKQMLKDLAKEKEKVTEKPLPMMNQREFIQFCKTLYSMFQGEPNENELFQAIATVTS
LVLQIGEAGQRGRTSETAEEREAVGSAQTPEGPPEDPVRVDGEKTALAQAEGGWSVTFEQ
ILASLLTEQSIFNFFEKPLDLKAKIGSARLNQYHERIHLLTIQEP
Download sequence
Identical sequences W5MX71
ENSLOCP00000012980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]