SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000013049 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000013049
Domain Number 1 Region: 166-280
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-17
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 
Domain Number 2 Region: 319-436
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.000000000000419
Family Cell cycle control phosphatase, catalytic domain 0.055
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000013049
Domain Number - Region: 125-177
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00366
Family Ypt/Rab-GAP domain of gyp1p 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000013049   Gene: ENSLOCG00000010638   Transcript: ENSLOCT00000013077
Sequence length 696
Comment pep:known_by_projection chromosome:LepOcu1:LG14:25420860:25446837:1 gene:ENSLOCG00000010638 transcript:ENSLOCT00000013077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDDPVFPSLPSFRDRELAEALDSGGCDLETVRNIIQGRELPTTQRAKIWKIALNVAGKGD
SLASWDGSLDLPEQTLIHNRCQQLIDPLSMSEEERSSALADTESVITFYCKSRNITFTAD
LSWPDLLRPLLTLRLPRSDLYNCFYAIMNKYIPRDCVPKGRPFHLYRLLLQYHEPELCSF
LDTKKITPDSYAMNWLGSLFASHCTPEVTQAMWDIYLQQADPFVIFFLMLIILVNAKDNI
LAQEGDSKEDIIKMLESSPAHLECEDVEDLFSLAQYYYSKTPLSLRKENQNLFGSSLVAL
KEEEMDLSQALCLPVSVPEILQANQQQGEGVRFFVVDCRPAEQYNAGHLSTAFHLDSDLM
LQNPSEFALSVKSLLEAQKQSLESGSIASGEHLCFMGSGREEEDMYMNMVLAHFLQKNKE
YVSIAKGGFMALQQHLADINVDGPDNVYVHWIVSTSGARGSLSSGADGESVNGASDGKGV
KSLVNKMTFALKSKSVNVKEKVISFIENTSAPVDRISFNLPWPEKAVPDRHVSSSDRVGK
PYRGVKPVFSIGDEEEYDTDEIDSSSMSDDDRKEIVNIQTWINKPDIKYHVPCSEVKETG
HMFPSHLLVTATHMYCLREIASRKDFAYIQSRQALNSVVKITSKKKHPELITFKFGNSNS
AGVEVLAVERYLIPNAGDATKAIKQQIMKVLDALES
Download sequence
Identical sequences W5MXE0
ENSLOCP00000013049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]