SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000013373 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000013373
Domain Number 1 Region: 359-497
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-42
Family C-type lectin domain 0.00023
Further Details:      
 
Domain Number 2 Region: 952-1107
Classification Level Classification E-value
Superfamily C-type lectin-like 1.82e-37
Family C-type lectin domain 0.00084
Further Details:      
 
Domain Number 3 Region: 1230-1371
Classification Level Classification E-value
Superfamily C-type lectin-like 3.61e-35
Family C-type lectin domain 0.00018
Further Details:      
 
Domain Number 4 Region: 808-940
Classification Level Classification E-value
Superfamily C-type lectin-like 7.73e-35
Family C-type lectin domain 0.0007
Further Details:      
 
Domain Number 5 Region: 643-792
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-34
Family C-type lectin domain 0.0000305
Further Details:      
 
Domain Number 6 Region: 1102-1232
Classification Level Classification E-value
Superfamily C-type lectin-like 2.16e-33
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 7 Region: 24-154
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.08e-32
Family Cysteine rich domain 0.00000593
Further Details:      
 
Domain Number 8 Region: 224-358
Classification Level Classification E-value
Superfamily C-type lectin-like 4.39e-32
Family C-type lectin domain 0.00077
Further Details:      
 
Domain Number 9 Region: 508-648
Classification Level Classification E-value
Superfamily C-type lectin-like 1.49e-31
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 10 Region: 154-212
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-20
Family Fibronectin type II module 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000013373   Gene: ENSLOCG00000010898   Transcript: ENSLOCT00000013401
Sequence length 1464
Comment pep:known_by_projection chromosome:LepOcu1:LG9:31438281:31482624:-1 gene:ENSLOCG00000010898 transcript:ENSLOCT00000013401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLFAVFMYLTLTFHISIQLDIGLFLIYNEDHSKCVTAVGINSVQTTSCNPSDKSQQFR
WVSENRLLSVSQKLCLGAVSKKDWVKVLLFPCDEKAELQRWECKNDTLFALKGADLYFNY
GNKNEKNIMLYKGNGLWSKWRIYGTKDDLCSRGYEDIFTLGGNSFGLPCQFPFKYDEKWY
AECTLDGRSDGQLWCATTADYKTDRKWGLCPTKYLMSSVTAATSGWDTHPVTGVLYQRNT
QAVLTWHQSRRSCQQQGADLLSIVELHEQTYLSEIGLTENLGSPLWIGLNSLEFETGWQW
IDGSPFRYLNWAPGHPSSQPGLNCAVLNPGKAAKWEDSVCSKKLGYICRKGNTTNVNPVI
PASTQPSYCPNHWVPYAGHCYYLERTKKIWKEALAACHKEGGDLASIHNIEEHSFVISQL
GYLPTDELWIGLNDQKMSMLFEWTDRTHVTFTKWLTGEPSHATNMQEDCVLMKGKEGKWA
DHVCEKAYGYICKKKALSIPQGSTAVVSEGCKAGWIRYGLSCYYVGSETQTFESATQKCR
SFEAHLVDIADRYENAFLISLVGLRSEKYFWTGLSNTADRDTFVWTNTAAVHFTHFNAGM
PVPKRRKQGCVALTTGTFAGLWDVINCDSNEKYICKHLADGVTTTPAPTTFPTGDCPSDW
TVMAQGKSCFKLFKKNLKNKKTWFEARDFCVAIGGDLLSIHSEAELHEIPVQFFILYYSI
IENAWIGINLHDPNAGFMWSDGTSVSYENWGYGEPNNHNDAELCGETSLFFGLPWNDRHC
EHYNNWICKIRRGVTLKAAPNATVPQYNMTQDGWIEYNGSQYYMNSQRLPMEDARDYCKK
NFGDLAVIEGESERTFLWKQISRGDEDQYYIGMTVGLDKTFQWLDGSPVSYVAWEKNEPN
FANNDENCVSMYKNMGFWNDMNCGAPLASICKRSSNFVNTTVAPTVIPKGGCLPDWLYFE
GKCYKMIGSNPAERKTWQDARNYCISVGGNLVSITNEKQQVFLTTKLQEMTADVWIGLND
INAEMRFLWTDGKGVYYTNWAKGNPVSVPDGRYLHSDEEFDCVVLVSSSPTMSGQWKVED
CLLSRPFICQRKSDPLINNPTTTAPPGGYIKFGNNSFKVINQKMNWDEARRQCKADDADL
ASILDSITQAFVRLLAHKYKEPMWIGLNSNVTFGYFTWIDNWKLRFTKWAAGEPRNNIAC
VYMDVDGTWKTGLCNNTYYSVCKQTKDVAPTEPPQLPGNCPEPKKRRVWVPFRGHCYTFS
ASVVDNWAHASVECMKLGGSLVAIEDPTEAVFLLQNAELQRDRAKSFWIGLYKNVNGAWL
WIDNSVVDYTNWNSGEPSRQNDECVEMFSDSGMWNNANCHSYKAYICKAAKVIPPTQKSP
KTEQHAGSGEQSPHGYAGIVVAIIILIITGAGLAAFFIYKRGRRPVQGECNFDNTLYFNT
DTSSSPVDTKVLVANIEQNEQATI
Download sequence
Identical sequences W5MYB4
ENSLOCP00000013373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]