SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000013580 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000013580
Domain Number 1 Region: 233-456
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.46e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0000078
Further Details:      
 
Domain Number 2 Region: 432-556
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000013580   Gene: ENSLOCG00000011057   Transcript: ENSLOCT00000013609
Sequence length 567
Comment pep:known_by_projection chromosome:LepOcu1:LG3:32041856:32169630:-1 gene:ENSLOCG00000011057 transcript:ENSLOCT00000013609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDNKIQFWKRNTKVPGSIQPVYGAQHPPLDPRIHKTFLKDGPKTNALSIKSKKASSFH
EFARSTSDAWDIGDDEDGTLSHVCRYVSMSCKGEIGLLENKYTTKTNRGQQKGKKKNQRA
KGRKSGGTGRQGVKQEVGEDERDEKIQTGIEQCPSECKACLIHSKCSAHKEAEWLPPVGS
WRNVLIRNTLHKQQSLPLRPIIPLIARISDQNASGAPPMTVREKSRLEKFRQLLASPNTD
LEELRKHSWSGIPREVRPITWRLLSGYLPANMERRELVLRRKREEYFGFIQQYYDSRNDE
HHRDTYRQLDADISTLGISCHVLECEVTHIHIDIPRTNPLIPLFQQASVQEVFERILFIW
AIRHPASGYVQGINDLVTPFFVVFLSEFVEEDVENFDVSALPLDTQRNIEADSFWCMSKL
LDGIQDNYTFAQPGIQIKVKALEELVSRIDEDVHNHFSKYEVEYLQFAFRWMNNLLMREL
PLRCTIRLWDTYQAEAEGFSHFHLYVCAAFLIKWRKEILSMVDFQGLLMLLQNLPTIHWG
NEEVGLLLAEAYRLKYMFADAPNHYRR
Download sequence
Identical sequences W5MYX1
ENSLOCP00000013580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]