SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000013588 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000013588
Domain Number 1 Region: 184-291
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-26
Family PDZ domain 0.003
Further Details:      
 
Domain Number 2 Region: 307-412
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-24
Family PDZ domain 0.000017
Further Details:      
 
Domain Number 3 Region: 7-100
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000697
Family PDZ domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000013588   Gene: ENSLOCG00000011058   Transcript: ENSLOCT00000013617
Sequence length 994
Comment pep:known_by_projection chromosome:LepOcu1:LG12:32639537:32953927:-1 gene:ENSLOCG00000011058 transcript:ENSLOCT00000013617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQITLSLTRTVEISGDDGPLGIHVVPYCSSLSGRTLGLYIRGVEENSRSKREGIFHEDE
CIVKINDIELMDKSFSQSQETFRQAMRYATVRLEVVPSQNRERYEKKLIGQLFSSDPAEG
VPKGNPPAALKGELSVRPVEPAAKPNEAHFNQHQDTGPAPTPPGTSLTPVTKSKSDSPLL
KKSPAAISPLVAFGNKKMGKKLKIDLKKGPEGLGFTVVTRDSSVHGPGPILVKNILPRGA
AIKDGRLQSGDRILEVNGMDITGKTQEELVGMLRSTKQGETVSLVVARQEEVFLPRELKG
EQDWAVPALESKEQLMFEIPLNDSGSAGLGVSLKGNKSRETGADLGIFIKSIIHGGAAFK
DGRLRANDQLIAVNGESLLGKSNHDAMETLRRSMSMEGNIRGMIQLVVARSLDRPNEEQS
NARQLMRKRFYSCPGAQSFVLKPANGLMPAVMVPNSIYETRPAPNQVMNGGYNTEEEERD
EDRPSLPIHLDADALKAAGSQRSDQMKSPEWQTSPNLQRESEHRNVKSSKSMDLGPPRGG
DLGPTLGLKKSSSLESLQTAMSEVKKNELPFHRPRPHMVRGRGCNESFRAAIDKSYDGPP
EADDDELSDQSSGRDTPASGSSRQGNPDNADESKKDKKKKAKEKKKDKAKTKGKEKDRKR
LEDIEEQDKKSKKKGFGAMLRFGKKKEEKGKTALQKQKSEMLSEEELGKMKEERERIEAK
HHELREKQARERFEALPDVEDDDADPNYARINHFREMPPGQGAYGNRTPSPPSPPAPVSH
GREAPGEEALEGLYAKVNKQRPLQPPPPDSTVDRIQQLRKEYQQARREGAAPAYEELEAR
QRPPEFDPHRIPRGHDSRLAIPRYEDVERQYASLPRRGPMEPNEYPLPPWAGQGEREPLR
YPGAQPMYPPYTSRGNYPRPSEPRQGEPSYYPPPPQQRGPLRQDVPPSPPMPLRSQRYDT
MTRTGYRTASPEGYGYGDGRRQDPRQKNAMTAAV
Download sequence
Identical sequences W5MYX9
ENSLOCP00000013588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]