SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000013591 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000013591
Domain Number 1 Region: 197-400
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.09e-52
Family Ypt/Rab-GAP domain of gyp1p 0.00000359
Further Details:      
 
Domain Number 2 Region: 376-500
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.97e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000013591   Gene: ENSLOCG00000011057   Transcript: ENSLOCT00000013620
Sequence length 511
Comment pep:known_by_projection chromosome:LepOcu1:LG3:32041856:32169630:-1 gene:ENSLOCG00000011057 transcript:ENSLOCT00000013620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDNKIQFWKRNTKVPGSIQPVYGAQHPPLDPRIHKTFLKDGPKTNALSIKSKKASSFH
EFARSTSDAWDIGDDEDDDFLGGPTLPSLPPPPPPSAHISSKVAVTATNPAPQFHGWGRE
KLKTDCYQSNGRVVKSQSEAQLSTATEGPPVRNTLHKQQSLPLRPIIPLIARISDQNASG
APPMTVREKSRLEKFRQLLASPNTDLEELRKHSWSGIPREVRPITWRLLSGYLPANMERR
ELVLRRKREEYFGFIQQYYDSRNDEHHRDTYRQIHIDIPRTNPLIPLFQQASVQEVFERI
LFIWAIRHPASGYVQGINDLVTPFFVVFLSEFVEEDVENFDVSALPLDTQRNIEADSFWC
MSKLLDGIQDNYTFAQPGIQIKVKALEELVSRIDEDVHNHFSKYEVEYLQFAFRWMNNLL
MRELPLRCTIRLWDTYQAEAEGFSHFHLYVCAAFLIKWRKEILSMVDFQGLLMLLQNLPT
IHWGNEEVGLLLAEAYRLKYMFADAPNHYRR
Download sequence
Identical sequences W5MYY2
ENSLOCP00000013591 XP_006628486.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]