SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000013865 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000013865
Domain Number 1 Region: 387-442
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000106
Family Ypt/Rab-GAP domain of gyp1p 0.021
Further Details:      
 
Domain Number 2 Region: 511-588
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000183
Family RUN domain 0.023
Further Details:      
 
Domain Number 3 Region: 360-390
Classification Level Classification E-value
Superfamily SH3-domain 0.000000249
Family SH3-domain 0.0031
Further Details:      
 
Domain Number 4 Region: 109-160
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000128
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000013865   Gene: ENSLOCG00000011278   Transcript: ENSLOCT00000013894
Sequence length 622
Comment pep:known_by_projection chromosome:LepOcu1:LG12:33809805:33821789:1 gene:ENSLOCG00000011278 transcript:ENSLOCT00000013894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASSPPSPQASMSGSYTPTPGGPFSALTPSMWPQDLLSKYYQKDSEELEIQYDEFGFRVES
EADGTELQPDQLSGTPLVEDPQQRLRWQAHLEFTHNHAVGDLTWEHISPTLARSDRLRAL
VLAGIPHSMRPQLWMRLSGALQKKRTSEITYREIVKNSSNDDTTAAKQVRVSTVPPHSLF
YSLWVLRSTVTISLSLQEDELVSSENSASIFNTLSDLPCQLTDGQQVLEEAVRLAGALSP
DQLEAQRRKHLAYILAEQAELNTAHTLGTGLGKVVRRQSQRRKSALTSLLFGDDEAEALK
AKNIRQTELVATLREAIGRLATHFHCLDPRHSSTDLTPDYSMESHQRDHENFVLVSRCRR
RRARALLDFERHDDDELGFRKNDIITVVSCLLLFLEEEDVLWMMCSLIEDLLPPSYFTST
LLGVQTDQRVLRQLIVQYLPRLDRLLQEHDIELSLITLHWFLTSAASREVERDFNSVYSR
LVLCKTYRLDEDGKVLTPEELLYRAVQSVNMTHDTAHAQMDVKFRSLICVGLNEQVLHLW
LEVLCSSVQSVEKWYQPWSFLRSPGWVQIKCELRVLSKFAFSLSQDCELPDRKEQEKEQK
PLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences W5MZQ6
ENSLOCP00000013865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]