SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000013978 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000013978
Domain Number 1 Region: 876-1044
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0074
Further Details:      
 
Domain Number 2 Region: 1019-1138
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.7e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0052
Further Details:      
 
Domain Number 3 Region: 162-190,290-419
Classification Level Classification E-value
Superfamily PH domain-like 8.71e-28
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 16-154
Classification Level Classification E-value
Superfamily PH domain-like 5.19e-22
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000013978   Gene: ENSLOCG00000011360   Transcript: ENSLOCT00000014007
Sequence length 1269
Comment pep:known_by_projection chromosome:LepOcu1:LG17:32426129:32489273:-1 gene:ENSLOCG00000011360 transcript:ENSLOCT00000014007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATDSQDDKTNNPSKSEKRFALWYMGWSPLDRRTTLPMLPWLVAEIRRRRERSEAGSAQ
AREVQIILIPPLIRCVPASNSSSSVFIFEHKAQHISRFIHNSHDITYFAYLIRTQPDNPE
SEMACHVFKASDPNQVPDVISSIRQVSKAALKEDAKTKQEGEEAFYNSQRFEVLYCGKVT
VLHKKAPSTLIDDCVEKFKQHELESKRIKLLNDQRGSTDSVSFIVGEGDPLTPLLSSPPD
RGEGGGAADSVNGNSVLSASASQASLHGSRSAFPECILEDSGFDDQQEFRTRCNSLAAGL
QKKVSDSNLTGPLRRRHASAPSHVQPSDAEKNRTMLFQVGRFEVNLISPDSKSVVLEKNF
KDISSCSQGIKQTDHFGFICREAIESGPSQYVCYVFQCASESLVDEVMLTLKQAFSTAAA
LQNAKTQIKLCEACPMHDLHKLCERIEGLYPPRAKLIIQRHLSLLNDNEQADIFERVQKM
KPSSDQEENELVILHLRQLCEAKQKTHLHIGETPQPNSSNSGLSESVSTSGRFKLDVLKN
KARKSLTNSLENIFSRGASRMRGRLGSMDSYERSSSLASDKDCSPGDSPPTTPPASPVSS
LGQAFPEEDPDSPQFRRRAHTFSHPPSSKKRISFPDSRSQSSRSPIQRQQSVAPELLQSS
PIAISRRTRSVSESDSSSSSIPASFSAPTFLKNLYQASSRPLPLADSGNFKSNGEGRKRT
FSGCSSDSLSAGVPPVTPRRISWRQKIFLRVASPMSKSPAAMQRKDRLDGTELLPLSPLA
PALEKDPLAALLQPEEAFVEKRPRHTAEDLRALWKKAIHQQILLLRMEKENQRLEASRDE
LHTRKIKLDYQEVGQCPKDVSAAWDKRLSVPGRAKARCDMEEIHSALSQGVPKNRRGEIW
QFLAHQYRLRHRLPCKQQPPDTSYKELLKQLTAQQHAILVDLGRTFPTHQYFSTQLGAGQ
LSLFNLLKAYSLLDVEVGYCQGISFLAGVLLLHMSEEQAFEMLKFIMYDLSFRKQYKPDM
VSLQIQMYQLSRLLHDYHRDLYDHLEENEISPSLYAAPWFLTLFASQFPLGFVASIYDLI
FLQGTEVIFKVALYLLSSHESRIMECDSFETIVDFLKSTIPNLTLAQMEKTISQVLEMDI
SKQLHAYEVEYHVLQDEMLEASSPTEDGDRLEKLEKANSQLKKQNMDLLEKLQAARLKIQ
SLELTMENFLTRESKMKHLIRSLEQEKAAYQKTIERMRSSLPQDMLSDVELTEIKCGSNS
KAKPGNKKP
Download sequence
Identical sequences W5N019
XP_015220026.1.81211 ENSLOCP00000013978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]