SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000014102 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000014102
Domain Number 1 Region: 469-644
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.36e-49
Family Ypt/Rab-GAP domain of gyp1p 0.0047
Further Details:      
 
Domain Number 2 Region: 625-722
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-19
Family Ypt/Rab-GAP domain of gyp1p 0.026
Further Details:      
 
Domain Number 3 Region: 789-916
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000655
Family Calmodulin-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000014102   Gene: ENSLOCG00000011473   Transcript: ENSLOCT00000014131
Sequence length 1219
Comment pep:known_by_projection chromosome:LepOcu1:LG6:32651220:32670980:-1 gene:ENSLOCG00000011473 transcript:ENSLOCT00000014131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWIVPEEVLLANALWVSERANPFFILQRRKGHGKGGGFTGLLVGTLDVVLDSSARVAPYR
ILHQTQDSQIFWSIACGSSRKEITEHWEWLEANLLQTLSIFENEEDITTFVKGKIQGIIA
EENKSKETTEEEDSGKFREAELKMRKLFGMPDEEKLVNYYSCSYWKGRVPRQGWLYLSVN
HLCFYSFLLGKEVTLVVQWTDVTQLEKNATLLFPESIRVSTRDSEHYFSMFLNINETFKL
MEQLANIAMRQLLDNESFSADRSLPRPCKPLKNVSALKRDLDARAKNERYRATFRLTQDE
KLDGHTDCTLWTPFSKMHVAGQMYVSNNYICFSSKEEDFCQLIIPLREVTIVEKADSSSV
LPSPLSISTKSKMTFLFANLKDQDFLVQRISDFLQRTPEKLWHNGKEQSDPPSPGFPLSA
SPPSPGSSQPGRFYSPDLPTAAQGLLSIFRRDAPEDLGPKATKEKMKEELWNIHFFEYGR
GVCMYRTSKTRDLVLKGIPDSLRGELWLLFSGAQNEMATHPGYYAELVEQSMGRCTLATE
EIERDLHRSMPEHHAFQNEMGIAALRRVLTAYACRNPNIGYCQAMNIVTSVLLLYCSEEQ
AFWLLVALCERMLPDYYNTRVVGALVDQGVFEELTRECLPLLYERMQELGVISTISLSWF
LTLFLSVMPFESAVLVVDCFFYEGIKLIFQVSLAVLHANMEQLLACSDEGEAMTILGRYL
DNVVNKQTPSPPIPHLHALLTSGDEPPPEIDVFDLIKSSYEKFGTLRADVIEQMRFRQRL
KVIQSLEDTAKRSVVRAIMTESAFGIDELEELYVLFKAKHIMSCYWGASSSAAERHDPSL
PYLEQYRIDMGQFSQLFGALTPWSCGVHTLALAARLFRLLDQNKDGLINFKEFVTGLSGM
YHGDMTEKLKMLFKLHLPPALCPEEAESALEATQFFTDDASPQDSPFLSEMDFLLQDVIS
GENAKPIATEEGTSNGNSENKKEEKPQDYKYYLRMWAKEREPKKETIKDLPKMNQEQFIE
LCKTLYNMFSEDSCEQELYHSIATVASLLLQIGEVGKKFSSNGGKKPEHNDVAGPVSDMP
EEERPAESPGGNPKEAQVSQAAEEPAEVPQLPASDEDTKDDTSVSSYSMVSAGSLQCEDI
SDDTVLIGCGDQRRGSSLDGDWSISFEQILASILTESPLVDYFEKKVDIRAKMAACKAQR
TVERQVSSSSECELPLLSG
Download sequence
Identical sequences W5N0E3
XP_015205426.1.81211 ENSLOCP00000014102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]