SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000014213 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000014213
Domain Number 1 Region: 4-167
Classification Level Classification E-value
Superfamily RUN domain-like 1.57e-28
Family RUN domain 0.0029
Further Details:      
 
Domain Number 2 Region: 157-255
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000933
Family PDZ domain 0.018
Further Details:      
 
Domain Number 3 Region: 296-424
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000109
Family Phosphotyrosine-binding domain (PTB) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000014213   Gene: ENSLOCG00000011566   Transcript: ENSLOCT00000014242
Sequence length 430
Comment pep:known_by_projection chromosome:LepOcu1:LG10:31124333:31144390:1 gene:ENSLOCG00000011566 transcript:ENSLOCT00000014242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPKDPLLGTLKVCILNLQSEGGAVTDESPHLSSCCQLLEIILRKGLQQTVLGLIRKDYW
HWLEQLPQQDSCGRLSQLSMAIEKTVSCKKVITSQGRGRYFLRLALNRRILGNVVQHLLH
TPKLLEWYDPAVSILRNEEFMEPFLSLLLVLSEMEFSLNIQNSSFLDESWMLPVYETYET
VPCRELGMVLRYLGKRVFVLELVEGSQAHADHFVRPGDIIDEINGVSLRNACNGQAGIVL
QRLKGKPLTLKLIRWLNSDGTVYRPMVKLLKALQQENPKFQLYPKSQASVEEGATQCLRD
GRIVYIVKYLGKADVGVFGGKEVLQQGIPLVLDQKLPGKTVLFDLKETHIICIEKSSKQE
LFQHHYPEISCVGRYSRSDQTIFAFCVSDCPETPEACSFSCVVMRASSAQECEEIVNRIA
AGFKHTEWFV
Download sequence
Identical sequences W5N0Q4
XP_015211565.1.81211 ENSLOCP00000014213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]