SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015574 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015574
Domain Number 1 Region: 41-286
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.2e-44
Family Protein kinases, catalytic subunit 0.00064
Further Details:      
 
Domain Number 2 Region: 442-611
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.41e-36
Family Ypt/Rab-GAP domain of gyp1p 0.0019
Further Details:      
 
Domain Number 3 Region: 589-701
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.89e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0087
Further Details:      
 
Domain Number 4 Region: 787-886
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 9.95e-16
Family Multidomain sulfurtransferase (rhodanese) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015574   Gene: ENSLOCG00000012644   Transcript: ENSLOCT00000015603
Sequence length 894
Comment pep:known_by_projection chromosome:LepOcu1:LG4:59949312:60026390:-1 gene:ENSLOCG00000012644 transcript:ENSLOCT00000015603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPLGDAQLGAFTFFASALPHDVCGSNGLPLTPNSIKILGRFQILKAVTHPRLCQYVDIT
RGKHERLVVVAEHYENSLKDLQKQGKPVSHVKVLQVAYEVLEGLEFMNRHRMVHRALAPH
NVLMDCKGSIKLAKFGLYHMTGHGADVDFPIGYPSYLAPEVIAQGTFHPHDPSRNETPLP
SGPKTDVWSLGILLFELCVGRRLLQTIDISERLKFILNLGCMDDIVTVLAEEHGCLEIIK
ELPENVVALLRKCLTFLPSKRPTPAELLRDSVFEGISSNYKPFQKPVSLFSSSLRCARLD
LPEDIGELCQGEEEDYLAERCIDEVYYLWCLAGGDLEKELTNKEIIQSKPPVCTLPNLVL
EDGECFGQGRDRSFLLDDTTVTLSLCQLKNRLKDVAGEAYYPLLEDEQSSLPQSNSSNEL
SAVATLPLIIRERDTEYQLHRIILFDRLLKAYPYKKNQVWKEARADIPPLLRGLAWAALL
GVEGDIQAKYDAIDKDTPIPTDRQIEVDIPRCHQYDELLSSPQGHVKFRRVLKAWVVSHP
DLVYWQGLDSLCAPFLYLNFNNEALAYACMSAFIPKYLYNFFLKDNSHVIQEYLTVFSQM
IAFHDPQLSNHLNEIGFIPDLYAIPWFLTMFTHVFPLHKIFHLWDTLLLGNSSFPFCIGV
AILQQLRDRLLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKSV
GGDNNGFSKSSSYFSTDDQDLPKTDLSREPIKLSELKAELSPRISAEDLIDLCELTGPGH
FKTPTKRIKSSKPKILAVDIRSSEDFHRGHISGSINIPYSTAFGPDGELVQCAANSTLQS
FKGRVIVVISNAMKSGAAFAAHLVKVCYPKVCILDGGINKMKPTGLLTVPSPQI
Download sequence
Identical sequences W5N4L5
ENSLOCP00000015574 XP_006629962.1.81211 XP_015201416.1.81211 XP_015201417.1.81211 XP_015201418.1.81211 XP_015201419.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]