SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015949 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015949
Domain Number 1 Region: 11-173
Classification Level Classification E-value
Superfamily RUN domain-like 2.88e-40
Family RUN domain 0.00053
Further Details:      
 
Domain Number 2 Region: 1427-1538
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.44e-28
Family Supernatant protein factor (SPF), C-terminal domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1228-1295
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.28e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015949   Gene: ENSLOCG00000012949   Transcript: ENSLOCT00000015979
Sequence length 1540
Comment pep:known_by_projection chromosome:LepOcu1:LG9:47853256:47888091:1 gene:ENSLOCG00000012949 transcript:ENSLOCT00000015979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAASVGESQLQRIIRDLHDAVTELSKEYRESGEPITDDSPNLHKFSYKLEYLLQFDQKE
KTTFLGTRKDYWDYFSDCLTKIKGANDGIRFVKSIPEFKTSLGKGRAFIRYSLVHQRLAD
TLQQCLMNEKVTSDWYYARSPFLKPHLNVDIINHLYELNEVQFDIASRGYDLDAAWPTFA
RRTLGLANSPSHFWKPPSRSSSISSLVSGYSQAHDIPSSPDFNHTLMSEPTSEVDDLRLE
LDQSELKQRELQDRIQQLEREKQNLLKASNVQDGLPEHESNLGQDSSQLRKMVEDLQKQL
EVALSSQRTVHDLQQCLKTLEDNSSEKQRELEKINKDYAIQLQVLTQELESLRVKESSAS
DLQAKIGSVEQKNVELLAKLDGVLSEKGQQIARDYDSAQKIHELLDKLNKAEKEKTEAQK
QSEERGKCVEKLTEELSLKHAAARESELKLGMLSATAEEERSKVVRQVEDLKAAIEKLQG
ALTIKEKESSNLQMQLQDAQSYSETLEKKTEELKKKALEENTELQLKYTNVKEILEGQIS
SLTEQLKAKEKEFSTSNKNVQHLEEQIKRLINEKEGLNNTVLELEANVKEQSIQLEDYKT
ECTNLKVQNEKFLQAAKRNEDLNKELMENRAALEDQLACLRASEKQLRSQIEDAKVSVDE
KEKKLREENRHLDESYQKAVMQNEVLEEGLKKLEVENEELKQEQANQKETFSARQVELRS
AKHMVSELEKNITALKSSENFLQEQLQSKCSLLEEKEQLCDELLGKIEMYENKVKEMETE
KSKAETVCAQQSELIASITAQKAAVEKVQLDQKANIAKEVNDVKTKLLVTENQLGLNVQE
VSRLQAEVLDLRSKVQSVSDDKLKAQAKLDVTEASRDEFKILTEQLKEQIEQLNREHVQE
LLSCKEKEERLRKEKECETAAKADLEKDVASLKEQLATLKKHNEKFVLENTETKECLHRA
NTEMAELGIQICTLTSENEDAKQKWTSISHQLQELNEEAAKEMDRLNASMAALRQENDSL
QEELRQSESLTSTILDLQSKLEKAERQVKNLQDSSKEEVSAVKFQMSSEIINHQNQIKNF
KEDLETVKEHLKAEQEKVSDLKAKVSELKAVSTEYTQQIEEKTAEVSRSELVIQQSNEEL
ERVKESLARAQEALSSAQKESQELSEKLNNLMTEKEKNDLQMSAEIDDLYRTKKNLEERL
IELIRDKDALWQKSDALEFEQKLRAEERWLVDKEVNHCLGCQSPFTWWLRRHHCRLCGRI
FCYYCSNNFVKTKHSGKKERCCRECYMQHSAVVERLPAAEVASPPETPTDSPKDLGQLPR
RLTPSVVVTDAAPKPDDAVFDIITEEEVNGIYDSDSVRDSPDSTREMEGQQRSPEVNAAV
GESTPDDLGEQMPTVQDAEICLLKSGELTLTVPLTIETIMQFGEGGRELFIKSSGYSVIP
IDVEEAGPTISWVFSSEPKSISFSVVYKESGDSPIEQAKVLIPLTRCNSHKETIQGQLKV
RNPGTYMLIFDNSFSRFISKKVLYHLTVEKPIIYDGSDFL
Download sequence
Identical sequences W5N5P0
ENSLOCP00000015949 XP_015210330.1.81211 XP_015210331.1.81211 XP_015210332.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]