SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000016169 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000016169
Domain Number 1 Region: 180-288
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-16
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Domain Number 2 Region: 34-104
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000262
Family Ypt/Rab-GAP domain of gyp1p 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000016169   Gene: ENSLOCG00000013127   Transcript: ENSLOCT00000016199
Sequence length 297
Comment pep:known_by_projection chromosome:LepOcu1:LG9:49329467:49350248:-1 gene:ENSLOCG00000013127 transcript:ENSLOCT00000016199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVMSEDPQRNFRSAYYEKVGFRGVEEKKSLEILLKDDRLDVEKLCTFSQRFPLPSMYRI
FVWKVLLGILPPHGDSHALVMSYRKQQYEDVLQALQVMRFVQSSTPQVEVYLHMHQLESL
ALPRRTEVTPLEPEAEDFLAIARAMAKIVESSVDCYWLIKCFVNQYSNKYGDSVPHLPKS
LEHFLSLEDSRLLNHLRTCNAMSKLPYNLWFRRCFAGCLPESSLQRVWDKIISGSCKILV
FVAVEILLGYKIMLMGMNKPEDITQFLENMPQENTDAIVTKAIDLWHKHCGTPMHSV
Download sequence
Identical sequences W5N6B0
ENSLOCP00000016169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]