SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000016368 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000016368
Domain Number 1 Region: 255-342
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000000217
Family Ypt/Rab-GAP domain of gyp1p 0.026
Further Details:      
 
Domain Number 2 Region: 150-229
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000034
Family Ypt/Rab-GAP domain of gyp1p 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000016368   Gene: ENSLOCG00000013286   Transcript: ENSLOCT00000016398
Sequence length 626
Comment pep:known_by_projection chromosome:LepOcu1:LG10:38990524:38998462:1 gene:ENSLOCG00000013286 transcript:ENSLOCT00000016398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSWLQFRRPRTNSSGKKPPSKDLDGSGKNVLNIPILTISESDNWEVSSSSTMKYWQFVD
WEKMEPKSALNYQKILQSDCKQLKSMARAGFWSTSHTLRAKAYHHIIHGISCRSVTPDRE
IYQQLSEKLFGKKKTSTHPFPEYMENGAIPMYCLSKTGVNSVRKILLCIAAHFPDITHCP
VLPALVSLLLHFSEDEAECFHNVCRLIAYNDPDKRYIDQTFLAHRASCMTFRDLANKYCH
GAHKLIATSNQSLFDIYSDWIMWIFGAGLPFEYAIRVLDVFLLEGYKVLYRVALVLLSLY
KGSVPSTPSHIANIRQDIMSFVGNISCHITVDKLLEKAFSIRLFSRKEINLLLSANMSAL
LQKGISIHQKRMSVHLAVDLDNFSSSIVTGQEMRMVWSWIPERFALFQPIMLFTTSEHGR
SLTSFYSQVEGSEPTVLLLKTEDEEVCGAFLSSDWSERNKGGGKGLSFFGTGECFVFTLC
PEMERYEWAILHQPKIAKETHIHSSPHLKPPPALATEVPPPVTLAGPGGTPQDPSYLTVP
FSVPSEGPPPEPAPRKPPKHPFPASMFMAGGTERIIIGGGGGQALCIAADLLNGWTEHCD
TFQNPPLCRDSFRIQCLEAWGIQNSL
Download sequence
Identical sequences W5N6V9
ENSLOCP00000016368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]