SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000016551 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000016551
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily PX domain 3.53e-31
Family PX domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000016551   Gene: ENSLOCG00000013423   Transcript: ENSLOCT00000016581
Sequence length 210
Comment pep:known_by_projection chromosome:LepOcu1:LG15:8907814:8915292:1 gene:ENSLOCG00000013423 transcript:ENSLOCT00000016581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRNQEEDEFIAVRVQDPKIQNEGSWNSYVDFKIFLHTNSKAFTAKTSCVRRRYSEFVWL
KKKLQKNAGLVPVPELPVKTPFFTLGDEDFIEKRRQGLQHFLDRVLHMTVFLSDSQLHLF
LQTQLAPADIEACVQGHAHYTVTDAILGYASSNQGWAQEEEGRTQEPGLLPVPYEWAGSP
TPLVPAAQCESSSEGGTPADDAPGRAEGGV
Download sequence
Identical sequences W5N7E2
ENSLOCP00000016551 XP_006638415.1.81211 XP_015217862.1.81211 XP_015217863.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]