SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000016721 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000016721
Domain Number 1 Region: 400-762
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.41e-128
Family Hect, E3 ligase catalytic domain 0.00000000308
Further Details:      
 
Domain Number 2 Region: 11-109
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.12e-20
Family PLC-like (P variant) 0.043
Further Details:      
 
Domain Number 3 Region: 289-329
Classification Level Classification E-value
Superfamily WW domain 0.000000000000526
Family WW domain 0.00072
Further Details:      
 
Domain Number 4 Region: 151-190
Classification Level Classification E-value
Superfamily WW domain 0.0000000000153
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 243-284
Classification Level Classification E-value
Superfamily WW domain 0.000000000264
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000016721   Gene: ENSLOCG00000013554   Transcript: ENSLOCT00000016751
Sequence length 769
Comment pep:known_by_projection chromosome:LepOcu1:LG10:40379321:40411012:-1 gene:ENSLOCG00000013554 transcript:ENSLOCT00000016751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPKCLKRFFSVSVAVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVRNTLDPKWN
QHYDLYIGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNVINRLKDTGCTYLSFNSLPP
FTSEVKHYSMTVSLQSRDRIGTGGPVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRT
TQWERPTRPASEYSSPGRPLSCLVDENTPIVGTNGATSGQGTDPRAQERRVRSQRHRNYM
SRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNVNCEELGPLPPG
WEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNNPKPNGSRVSMESQNSNLSRQNQ
LKEQHQPPQVLVSPSQLPEEPECLTVPKYKRDLVQKLKILRQELSQQQPQAGHCRVEVSR
EEIFEESYRQVMKMRPKDLWKRLMVKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQY
SRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITL
DDMESVDPDLHNSLVWILDNDITGVLDHTFCVEHNAYGEIIQHELKPSGKSIPVTEESKK
EYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKSFDEKELELIICGLGKIDIADWKS
NTRLKHCTPDSNVVKWFWKAVESYDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFT
IHQIDASTNNLPKAHTCFNRIDIPPYETSEKLYEKLLTAIEETCGFAVE
Download sequence
Identical sequences W5N7W2
ENSLOCP00000016721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]