SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000017647 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000017647
Domain Number 1 Region: 9-93
Classification Level Classification E-value
Superfamily PDZ domain-like 2.4e-16
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000017647   Gene: ENSLOCG00000014331   Transcript: ENSLOCT00000017679
Sequence length 1570
Comment pep:known_by_projection chromosome:LepOcu1:LG7:37234033:37290657:-1 gene:ENSLOCG00000014331 transcript:ENSLOCT00000017679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METIEQLVSFHHIQVQLNGGAPWGFTLKGGLEHGEPLIITKIEEGGKAALCKKLRVGDEL
VNINGSALYGSRQEALILIKGSYRILKMVVRRRSVPVIRPHSWHLAKLSESSADAPAMHL
HPGSYNLPWHTGGDASDLPMQWTQLSRNCSTDRSSSIGSMESLDQPSHGYYERQLSPVDQ
AVFNNKRDSAYSSFSASSNTSDYTVSLRADEASSMDNLLQGLGSCRHADGRCLHGAGEAG
EFSEEGKSRFPAKHPEAKGRPSSYSYEEDRENAIAREPPQPPARRESFIATQAVSGSIDK
RRASAPVDMLSLSSSWIRESRSSMRSEASNQECCPCDTGGSRDCKENGTVEQYYTLSSQL
EPCCDYQETDRLDASPLLDEASRPDPIDSSSHVSFVSKKKHLVMAHRHSAPEKLVSSQLH
CLDLSNSSQGRSSSPHNQWVKSSLCHGESPEAPSSDALSQSKWAESRCSTPGSAVNSEME
ESRVEADVLEAALPTQHTWGRSLSVPGDTVSCHSKPVQAFDSTNQSMDVLLEEQLIPKPN
SSRHRSSKSRRRSERFATNLRNEIQRKKAQLQKSKGSSSLLYGEEMVEEVSEQPECEAAG
GESVPSSQGMDSRPSKASIASGAKIGLPSTGSPKKTVCATASPPGQVSWPDNGTRCQEAD
EVGACGKGGRWKWTPEHKLQPKGMPERKCKWEVTRAPRTTKLADAPEECDIPPFADRRKF
FEETSKSLSTSHLPGLVTRHNKPTHPRTLQAKLEHSGSSLEQSWRRYSASAGFSSKEASV
CCPSESRGLEQQVVNHQEKEECDPEQDFCCGHQLLKPVPLEPQPCFVNEDCKRSPKRCQQ
PCKHYARPQHSAFHPVTAAVCDDCSPPRVPCNPRSRTPTENLNITTAVLMLKHFSKYNVC
RKHSYEGLWNIRTANPQKAHPARDQEHTNTNRKLSLTERDYQHHKHDLQTAEGAVEQENT
HWGRWSEAQGFDLPSPPPHPDERAPCYPQRGRALSESDIRLDLQRLRHRAMVFGGQALSE
LEEAAPRKKGPPPPRPPPPNWEQYRRRRASQHSLYAPSSPCEPAAPSQLTRPVHPGHNLE
TSRQRSHSLPLRGFSESCLHCCKEHVATPRSPTSPPATFTPACCLREDSEHGDSEPRGAT
DSLAQPPNLHTSTEAEMDRPAALRLVTVSQRTVEWDRSSVPAGLHCLGINAENGSRGLPE
SYFSMNYEQHRELNRSREEPSKPAQKALPVHHFSETPLETDIDEFKEDEIEEELARIGHN
DPQHVTVLETNIDTLPQEVGCPVAESRSGGTSTADVLGPDVGLKSRTDLTGELFPQMGGE
CGLGQPRRCSRSALEFSVDTLEKRSRQGSSGSSCSAYYSTSAAKAHLLSKMKELPGLNQE
EEEDELFFKKQQLIDSLRKKLTVLREAQKDLQEDITANGALGEEVETLVQAVCKPNEVDK
FRMFIGDLDKVVNLLLSLSSRLVRVESTLDSLSPDANHHERLTLLEKKKQLLGQLGEAQE
LKEHVDGRERAVCQVLARCLTPDQLRDYSHFVKMKAALLVEQRQLEDKIRLGEEQLKGLR
ESLGMGYGHY
Download sequence
Identical sequences W5NAI8
ENSLOCP00000017647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]