SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000017659 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000017659
Domain Number 1 Region: 177-365
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.11e-45
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 2 Region: 343-451,687-768
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000017659   Gene: ENSLOCG00000014341   Transcript: ENSLOCT00000017691
Sequence length 824
Comment pep:known_by_projection chromosome:LepOcu1:LG1:341349:349250:-1 gene:ENSLOCG00000014341 transcript:ENSLOCT00000017691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEEERGVVRVRVKKCEGVLPAEYRSFAVDPQITSLEVLQHILIRAFELNGKRNFGISY
LSRDKQGVEAYLSLMSDWDLDAAFVSAAKPYLQLKIEIKPSEDSPLLEDWDIISPKDVIS
SDLIPGERRSLAAAALPFTQSLISQVGRTLSRVQQALSWSYGEDVKPFKPPLSDSEFHSF
LSHLGQLTRPEELRLRIYHGGVDPSLRKVVWRYLLNVYPDGLTGQERMDYMKRKTREYDR
LKGEWGARTTPEDLEFIRGNVLKDVLRTDRAHPYYAGSEDSPHLAALADLLTTYAITHPQ
VSYCQGMSDIASPILAVMDNEAHAFICFCGIMKRLEGNFRPDGRLISVKFQHLKLLLRYS
DPEFYAYLVSRGADDLFFCYRWLLLELKREFAFEDALRMLEVTWSSLPPDPPETEVELLG
PAQEEEEEEEAGRRRKGEQRRRHMLRPSREELAGPAGEREEGDGGRPPPEELESRGRGEG
DEEGDQGTPVSMPQAEEGKQPSFGEFKYYSARQGDSFDLEEGPPISPGSPLPDGRSSLPS
RQPTEDSEEDPGESDPLIRPGESISTPASGGRRSPNGQTSSPTSSPSLANGRVSPSPPAG
RHSVSSPSLAGRRLASPATPTGRPSSSPCVASGRVGSPAAATGRSLVSSPVFSDGRAGSP
STPTGKTPMASPCPGTRSASPKTATPSTPVPDKEDKPAPTPSLPPPQEFGKGNPFMLFLC
LSILLEHRDHIIKNNLDYNELAMHFDRLVRKHNLNRVLQRAKALFANYLQSEVWDSEEGD
EASSDSPAAQTPQPQPPPPNPNSTYNLSSVYSPSSPYALHPSSS
Download sequence
Identical sequences W5NAK0
ENSLOCP00000017659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]