SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000018193 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000018193
Domain Number 1 Region: 464-641
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 
Domain Number 2 Region: 619-717
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.32e-16
Family Ypt/Rab-GAP domain of gyp1p 0.024
Further Details:      
 
Domain Number 3 Region: 785-913
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000698
Family Calmodulin-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000018193   Gene: ENSLOCG00000014769   Transcript: ENSLOCT00000018225
Sequence length 1137
Comment pep:known_by_projection chromosome:LepOcu1:LG7:42335790:42358224:-1 gene:ENSLOCG00000014769 transcript:ENSLOCT00000018225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLKPEEVLLKNALKLWVTEKSNDYFILQRRRGYGEGGGGLTGLLVGTLDTVLDSTAKVA
PFRILHQTPDSQVYWSIACGATREEIVKHWKWLEQNVMRTLSVFDSSEDITSFVQGKIRG
LIAEEGKSSLVKEEDPEKFREALLRFEKWFGLPEKEKLVTYYSCSYWRGRVPCQGWLYLS
TNFLSFYSFLLGSEVKFIISWDEIWKLEKTSNVILTESIHVFARGEDHYFSMFLHLNETF
LLMEQLADYAIKRLFDKETFEGDPALSDPLQVTKRGLETRARNEQFRAFFRLPREENLLE
VHESFLWVPFSHFNTLGKICVSENYLCFASQDGSQCYVIIPVREVVGVEKSDSANKALTV
CVRGKRAVRFSEVRDFERLAYIIRMRCGTAASPQHSGTREQITEACQSLIEHFEDNPEEV
ALMVGQKGTSKTVSTEALMTVFHPQDAENLDPKMLKEKMKEQSWNIHFAEYGRGMSMFRT
KKTRDLIVRGVPEALRGELWLLFSDLPGAVNDMATHPGYYTELVEKSMGTCTLATDEIER
DLHRSLPEHPAFQSDTGISALRRVLTAYAYRNPKIGYCQAMNILTSVLLLYAKEEEAFWL
LVAVCERMLPDYFNRRIIGALVDQAVFEELIRERLSQLTEHMTDMTFFSSVSLSWFLTLF
ISVLPIESAVNVVDCFFYDGIKAILQLGLAVLDYNMDRLLTCRDDAEAVTVLNKFFDNVA
NKDSPLPATVLQQAPVGSDGNKSHPRVDITDLIKDSYEKYGGIRSEEVESMRRRNKLYVI
QTLEDTTKQNVLRVVSQEVKFSSTELEDLYNLFKRQHFLSCYWTMNSPILLHHDPSLPYL
EQYQLSHHQFRALFLLLSPWAHCANLDALTLWTFRLLDENQDGLINFKEFCCALDVTYSG
TFTEKLKFLFKIHLPPAFTEIETESPVFSKGNSFSKEDLSYLSRLNVSLPDASEDGVIRK
SPERGKGKVDLQAYLKQWQDELLKKEESIKDLPRINQAQFIQFSKTMYNLFHGDPEEESL
YRAIARVTSLLLKMEEVGRRLQGSGTLTQAAPVQSDTVQPESKALPPSESSPGSPSMPST
AEGGLQPEEMEWSFSFEQILPSLLNEPVIVRFFEKPAGIQAKLEHAKTAQLRAQNKK
Download sequence
Identical sequences W5NC34
ENSLOCP00000018193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]