SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000018242 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLOCP00000018242
Domain Number - Region: 276-306
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0654
Family Ypt/Rab-GAP domain of gyp1p 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000018242   Gene: ENSLOCG00000014813   Transcript: ENSLOCT00000018274
Sequence length 322
Comment pep:novel chromosome:LepOcu1:LG2:67635728:67640559:1 gene:ENSLOCG00000014813 transcript:ENSLOCT00000018274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTTTREDFEWVYTEQPHSTRRREILAKHPEIKSLMGPDPYLKWIVTAMVLTQLLACYL
VRDLSWKWLFFWAYAFGGCVNHSLTLAIHDISHNAAFGNKEARWNRLFGMFANLPIGLPY
SVSFKKYHIDHHRYLGGDRLDVDIPTALEARLFSTPLRKVVWLVLQPFFYALRPLCVNPK
PVSQLELLNGLVQLAYDLALYQLWGMKPVVYMVAGSLLCLGLHPISGHFIAEHYMYLKGH
ETYSYYGPLNWLTFNVGYHMEHHDFPSIPGCRLPQVKKMAPEFYDHLPQHDSWIRVLWDF
VFCDQLGPFSRIKRECRLVKED
Download sequence
Identical sequences W5NC83
XP_006627679.1.81211 ENSLOCP00000018242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]