SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000018300 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000018300
Domain Number 1 Region: 113-269
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-20
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000018300   Gene: ENSLOCG00000014859   Transcript: ENSLOCT00000018332
Sequence length 272
Comment pep:known_by_projection chromosome:LepOcu1:LG1:3658345:3675501:-1 gene:ENSLOCG00000014859 transcript:ENSLOCT00000018332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSDSECGSPWFPCTELSQLISDLQSFLLVLDRENLSYIAQAKKKSISDLLSRMQDTPAQP
EFRDDRHRPIPLRKMLLIPESSDTKLYKNKVRSKQGQSDVAALPSDPPDDPDDGCYEEAE
PFFPSGPPTEGVDSDSSHYESYGEEEEEEEEEDSVKDRAHYIQWRSSQPCLRPAPESRIC
GYLWRKRWLGQWTRQLFVIRNHLLLCYKCAKDLQPLLELCLQGCHAVYKSKLNKKIQHEL
KVVTSVETVVLGFPSRQQAEEWRKIIEEVSGS
Download sequence
Identical sequences W5NCE1
ENSLOCP00000018300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]