SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000019576 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000019576
Domain Number 1 Region: 14-298
Classification Level Classification E-value
Superfamily Terpenoid synthases 1.58e-76
Family Isoprenyl diphosphate synthases 0.000000000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000019576   Gene: ENSLOCG00000015898   Transcript: ENSLOCT00000019608
Sequence length 302
Comment pep:known_by_projection chromosome:LepOcu1:LG16:5652013:5672524:-1 gene:ENSLOCG00000015898 transcript:ENSLOCT00000019608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQAMDGDKAAASERILLEPYRYLLQLPGKQVRTKLSQAFNHWLNVPDDKLQVIIEVTEML
HNASLLIDDIEDNSKLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLEHPEAVQVFT
RQLLELHRGQGLEIYWRDTYTCPTEQEYQQMVLQKTGGLFGLAVGLMQLFSSYQRDLKPL
LNTMGLFFQILDDYANLRSKVYSENKSFCEDLTEGKFSFPIIHAIWSHPESTQVQNILRQ
RTENVDIKRYCVDYMEKVGSFAYTRQTLQNLEAEAYRLIQDLGGNLELTALVEQLSKTYK
ET
Download sequence
Identical sequences W5NG17
ENSLOCP00000019576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]