SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000019771 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000019771
Domain Number 1 Region: 413-537
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.12e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0000456
Further Details:      
 
Domain Number 2 Region: 307-437
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.88e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0000404
Further Details:      
 
Domain Number 3 Region: 218-306
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.28e-17
Family Ypt/Rab-GAP domain of gyp1p 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000019771   Gene: ENSLOCG00000016050   Transcript: ENSLOCT00000019804
Sequence length 548
Comment pep:known_by_projection chromosome:LepOcu1:LG8:23155167:23372812:-1 gene:ENSLOCG00000016050 transcript:ENSLOCT00000019804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNDGSKKQFWKRNVAKVPGSIQHVYGAQHPPFDPLLHSNLIKHGNKTQTTPVKPKKATT
FQEFESITSDAWDVGDDDDELLAMAAQNLNIEVVMETANKVIENHSKLQEQQKQQEDTSE
KCEEEEEGEETAPELSFQLEPGHYSDNRMVKSLSEAHIVASKEGVFERATLQRQQSLPHR
RVIPLVARMADQNTSGTPAMTEREASRLDKFKQLLAGPNTDLDELRKLSWSGIPRQVRPI
TWKLLSGYLPANAERRESTLQRKRQEYFGFIEQYYDSRNDEHHQDTYRQIHIDIPRMSPE
SLILQPKVTEIHIDIPRTNPLIPLFQQASVQEIFERILFIWAIRHPASGYVQGINDLVTP
FFVVYVFEYIEEEVENFDVSSLPEEALRNIEADSFWCMSKLLDGIQDNYTFAQPGIQRKV
KALEELVSRIDEHVHRHLQQYEVEYLQFAFRWMNNLLMRELPLRCTIRLWDTYQAEPEGF
SHFHLYVCAAFLVRWRKEILEEKDFQGLMILLQNLPTMHWGNEEISVLLAEAYRLKYAFA
DAPNHYKR
Download sequence
Identical sequences W5NGL2
XP_015208169.1.81211 ENSLOCP00000019771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]