SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000019773 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000019773
Domain Number 1 Region: 218-416
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-52
Family Ypt/Rab-GAP domain of gyp1p 0.00000334
Further Details:      
 
Domain Number 2 Region: 392-468
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-22
Family Ypt/Rab-GAP domain of gyp1p 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000019773   Gene: ENSLOCG00000016050   Transcript: ENSLOCT00000019806
Sequence length 472
Comment pep:known_by_projection chromosome:LepOcu1:LG8:23228530:23372812:-1 gene:ENSLOCG00000016050 transcript:ENSLOCT00000019806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNDGSKKQFWKRNVAKVPGSIQHVYGAQHPPFDPLLHSNLIKHGNKTQTTPVKPKKATT
FQEFESITSDAWDVGDDDDELLAMAAQNLNIEVVMETANKVIENHSKLQEQQKQQEDTSE
KCEEEEEGEETAPELSFQLEPGHYSDNRMVKSLSEAHIVASKEGVFERATLQRQQSLPHR
RVIPLVARMADQNTSGTPAMTEREASRLDKFKQLLAGPNTDLDELRKLSWSGIPRQVRPI
TWKLLSGYLPANAERRESTLQRKRQEYFGFIEQYYDSRNDEHHQDTYRQIHIDIPRTNPL
IPLFQQASVQEIFERILFIWAIRHPASGYVQGINDLVTPFFVVYVFEYIEEEVENFDVSS
LPEEALRNIEADSFWCMSKLLDGIQDNYTFAQPGIQRKVKALEELVSRIDEHVHRHLQQY
EVEYLQFAFRWMNNLLMRELPLRCTIRLWDTYQFSRYHLIFGFAYGLFSDFL
Download sequence
Identical sequences W5NGL4
ENSLOCP00000019773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]