SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000020036 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000020036
Domain Number 1 Region: 301-496
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.67e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0018
Further Details:      
 
Domain Number 2 Region: 473-594
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.26e-35
Family Ypt/Rab-GAP domain of gyp1p 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000020036   Gene: ENSLOCG00000016247   Transcript: ENSLOCT00000020069
Sequence length 668
Comment pep:known_by_projection chromosome:LepOcu1:LG8:27781775:27841587:1 gene:ENSLOCG00000016247 transcript:ENSLOCT00000020069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMLTLPIVVLYEQEGIFIHSDSERNEDQDSLISGFLRVTEKEGELIVEYKPMEDAVDPS
NILCAGKDSSSVVEWTQCPKERMQKNVENQLSYEAEWDMVNTISFKKKPYTNGEGVLSHV
HERNKWAFFFNVGDLKTIKIKKEGWPYLVFCLKDETSLPALHFHQGGSELFLDCLKKHVL
LDESPFDQTVLIVNNHSKALSQSFENLFDDTTFGLVQKFKKDPYTTTLGGFSKVTNYLFD
AFRGQDAEHLQRPASEVADLLSEAIPGLEINHQEEPGFEVITRIDLGSRPEVERREPVSI
EEWTGKVDSEGRIQNVLHLKLIIFKGGLCHVVRKEAWKFLLGYFPWNSTRDERKNLQKRK
TQNSFSVLLQRISIHEFLQAGNHSKHCSLLFLEKDVNRTDRTNTFYEGPDNPGLILLHDI
LMTYCMYDFDLGYVQGMSDLLSPILYVMENEVDAFWCFVSFMEQMHQNFEEQMQGMKTQL
IQLSTLLRLLDITFWNYLESQDSGYLYFCFRWLLICFKREFSFQDVLRLWEVMWTGLPCQ
NFHLLVCCAILDSEKQKIMDEHYGFNEILKHINELSMKLDVEEVLQKAEAICLQIKNCKD
LPSAVCEILGVKSEALNPAAESSEQKTLPVKQTSKMMHAVEPNQSSVPLDRDGQSREPAQ
VVFSLPHA
Download sequence
Identical sequences W5NHC7
ENSLOCP00000020036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]