SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000020126 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000020126
Domain Number 1 Region: 100-194
Classification Level Classification E-value
Superfamily PDZ domain-like 9.33e-30
Family PDZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 24-77
Classification Level Classification E-value
Superfamily L27 domain 1.33e-19
Family L27 domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000020126   Gene: ENSLOCG00000016303   Transcript: ENSLOCT00000020159
Sequence length 228
Comment pep:known_by_projection chromosome:LepOcu1:LG8:30699493:30725027:-1 gene:ENSLOCG00000016303 transcript:ENSLOCT00000020159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLNVQTSSKTLEATLDVLYYSSVHLDVARAIELLEKLQESGDLPVSKLQSLKKVLQSEFC
TAIREVYQYMHETITVNGCPEYQARATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNV
MGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDTV
KLVVRYTPKVLEEMEARFEKLRTARRKGNEQLIELELEQLHQHQRGEQ
Download sequence
Identical sequences W5NHL7
ENSLOCP00000020126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]