SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000020492 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000020492
Domain Number 1 Region: 46-384
Classification Level Classification E-value
Superfamily Terpenoid synthases 1.9e-46
Family Isoprenyl diphosphate synthases 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000020492   Gene: ENSLOCG00000016588   Transcript: ENSLOCT00000020527
Sequence length 387
Comment pep:known_by_projection chromosome:LepOcu1:LG1:40562974:40639230:-1 gene:ENSLOCG00000016588 transcript:ENSLOCT00000020527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFYQRWRRPLKCQKSKKCNRGHRNISLFSNSSPSNWSKVVSDAEKIVGYPTSFMSLRCLL
SDELSNVAMQVRKLVGTKHPLLNTARGFVYDSRNNLQMRGLVVLLISKAAGPSTATTDLL
QQDMVSGIYPSQRNLAEITELIHTAFLVHRGIVNLKDWINSDGPLKDMEFGNKMAVLSGD
FLLANACTGLAQLNNTKVVELVSSAIGDLVQGIYYENTSAAKEEQVTEDITVASWEEQTF
LSHGALLAKSCQAAMELAKHDEESQALAFQYGKHMALGHKINSDLLPFVKGSTGELGTFS
LNSAPVVFHQELVGREGWMHQLQQARPQGRPLDYPKLWGAIKAGQGVNAVIDLCCYHGNK
ALEAIKCFPPSEARSALENIACAVTRF
Download sequence
Identical sequences W5NIN3
ENSLOCP00000020492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]