SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000021093 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000021093
Domain Number 1 Region: 237-394
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-31
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 370-503
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-18
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000021093   Gene: ENSLOCG00000017068   Transcript: ENSLOCT00000021129
Sequence length 738
Comment pep:known_by_projection chromosome:LepOcu1:LG8:49025377:49063229:-1 gene:ENSLOCG00000017068 transcript:ENSLOCT00000021129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPVQLGRSELLEIDICAGRGSGGEDGGSPPADGFSAFQRWVPARRKTVRESSQRGENE
GFPAEQNGTPATRPSPTQPRNGEIVDCLLVELYDTYSGSGGKSADSVDSSTEASSSDAFL
GRSNTGSNFLLELQEKHTRRHQMKYLAQKDTEELKWIVQEVNYRIGIQSAKLVRQLRRKD
RLYHKLQKNSDIVTACLQAVSQKRRVDTRLKFTLEPSLGKNGFQQWYDALKAVARLPTGI
PKEWRKRVWLTLADQYLHSISIDWEKTLRFAFNDRSNPDDDSLGIQIVKDLHRTGCSSYC
GQEAEQDRVVLKRVLLAYARWNKAVGYCQGFNVLAALILEVVEGNEGDALKVMIYLIDKV
LPDSYFANNLRALLVDMAVFRDLLRLKLPELSQHLDNLQKAANREVGGSYEPPLTNVFTM
QWFLTMFATCLPHHTVLKIWDSVFFEGSEVLLRAALAIWARLGERIESCQSADEFYSTMG
CLTQEMLEHNLVDSNELMQTVYSMAAFPFPQLAELREKYTYNITPFPAHVKTSSGKLGRG
RDSDEEIDIDDEDALVSAIGCLGPLSGLLGPELQSYQKQLKDHKGEQSLRSCGNIAELSP
GAVDASRSDYQATFNSMMMERMTTDISALKKQYIRIKRRQQQQASLVYIKPDKGPATSLL
PSQIPQSPVMNHLLLGKKLKPSERGCRNAIVHVPGSGSPPTPQEDLRAKLNSPWRTHVRV
HRKNVARAKGQLGYGDAL
Download sequence
Identical sequences W5NKD4
ENSLOCP00000021093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]