SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000021339 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000021339
Domain Number 1 Region: 1190-1288
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000000157
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000021339
Domain Number - Region: 3-53,145-326,439-537,997-1050,1090-1108
Classification Level Classification E-value
Superfamily ARM repeat 0.000777
Family Leucine-rich repeat variant 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000021339   Gene: ENSLOCG00000017251   Transcript: ENSLOCT00000021376
Sequence length 1316
Comment pep:known_by_projection chromosome:LepOcu1:LG1:66115577:66180262:-1 gene:ENSLOCG00000017251 transcript:ENSLOCT00000021376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHFSSEDEVELQSLLRHLLESVKERIRGAPSAECAEEILLHLEETDENFHNYGFIMYLR
HYVENMLGSVIEAETECCASGEGQGVGPGQDTLVHAVTRRTRESNEYKEMILSLKNTMMV
AVESLINTFEEDKLRKEETHGKSQHEQLSSHYTDNCSDSDCSFNQSYAFIKQEQLQAIAE
KIDSSQPKEVRWEALQTLCCAPPSDVLSCESWTGLRRNLSAALGDPDPAFSDKVLKFYAK
TFSSSPLNITREIYTSLAKHLESVFLSQKTSFSTAAGLDISNQDVARLLKKMRLLNEFQK
EVTSFWIRNPEKYMEEIIESTLSLLSLNLDQSLKTTSADKVLEPIYFLSMLDIKANWFKK
WMHGYYSRTVVLRLLENKYKSLIVASLQQCINYYESCESSCDKTSNIAHVRQQQQTGTTQ
RMFYTARQLEYTYFVHSVCLLGRLLMYTHGRKLFPIKLKRRKDPVTLTDLIVILIRIMYR
HPIPYYSEIPHVDSLSPACLVMDVLRTLCDRKECAVECLYAIAVIELLLSPIIALLKGKQ
VNLTSPETTLTHIADILARIATTERGLSLFLYDGNFIYTEGEGISAAHVIVQFTKKLLAD
KISVLSEAGPLTSLKGAFIFVCRQMYNTCEGLQVLKPYGLHDCIAEAWKQICRHSASSKN
TIVQTVSLSERVPTPVPGDCSSSATQDSQNNMVWEETLLDNLLNFAATPKGLLLLQQTGA
INECVTYMFSRFTKKLQVSRCEKFGYGVMVTQVAATAPGVAAIWSSGFVQAIVLELWSVL
ECGRDEVRMIHPKSTPMDPIDRSCQKSFLALVNLLSSYSAVYELLVKQELPNKPEYPLRE
MPTSIIDLIDRLIIINSEAKIHSLFNFEQSHTFGLRILNVVCCNLDSLLLLESQYRISEI
LLQSQKDNVSESSGSEGQFIIDGLSIERNHILVRINLIGGPSERFLPPRVLQKGPDPYPW
PMFSTYPLPNCYLHDVPKIVPCKQETEISKFLAFSKNPEKQANWMETCRKQFCKAMATKP
DIIKGNVLADLLEKTTIHLSSSPSECFFLSQDYKALDSSVKNQNLSTLEQLGIKMSIRYG
MYLKLIKEDVEQELCLLMKHCQTFLSQQQIKVKSPLYCLLGAYPGHDWFASSVFLIMSGD
KERALKFLLPFSNLLASAFLWLPRLHASVHHPVDIAESGIHPIYSCTAHYVEMLLKTEVP
LVFSAFRMSGFTPSQICLQWLGQCFWNYLDWPEICHYICTCIVMGPDYQTYICIAVLKHL
EEEILQHTQVQDLQVFLKEEPIHGFSISNYLEYMESLEQKYRTMVLTDMKNIKLKS
Download sequence
Identical sequences W5NL30
ENSLOCP00000021339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]