SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000000350 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000000350
Domain Number 1 Region: 94-189
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-30
Family PDZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 16-71
Classification Level Classification E-value
Superfamily L27 domain 1.12e-25
Family L27 domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000000350   Gene: ENSLOCG00000000316   Transcript: ENSLOCT00000000350
Sequence length 205
Comment pep:known_by_projection scaffold:LepOcu1:JH591704.1:1278:7543:1 gene:ENSLOCG00000000316 transcript:ENSLOCT00000000350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTDFRHKMAAIGEPVRLERDISRAIELLDKLQRTGEVPPQKLQALQRVLQSEFCNAVREV
YEHVYETVDINSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQ
NSPIYISRIIPGGIADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGAVKLVVRY
TPKVLEEMESRFEKMRSAKRRQQNS
Download sequence
Identical sequences W5LW43
ENSLOCP00000000350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]