SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000000498 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000000498
Domain Number 1 Region: 231-302
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000068
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 2 Region: 47-70
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000127
Family CCCH zinc finger 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000000498
Domain Number - Region: 326-352
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000103
Family CCCH zinc finger 0.0078
Further Details:      
 
Domain Number - Region: 21-42
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000157
Family CCCH zinc finger 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000000498   Gene: ENSLOCG00000000455   Transcript: ENSLOCT00000000499
Sequence length 402
Comment pep:known_by_projection scaffold:LepOcu1:AHAT01042582.1:6231:12222:1 gene:ENSLOCG00000000455 transcript:ENSLOCT00000000499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERTGFTCRANGKRVPLAGRAPCRQFINGCCRFGSNCHFSHELPVLKSTQICKYFQKGGC
WFGDRCRYQHVLQPDGGAVGSRRGSAPALQPIWEGSVLQNRRGSEPSISMARGSYARNRR
GSEPLVASFASQQRNFERLSVEIKEEEEHAAAEGAPTEQEQKLQMQNSLAVSHNVPQPID
GATSNVASMPLLAVAGVALEDSRGSASGMVASQRGAAPSESRAQAERSAAEAYDQSKDVT
CGICMDKVYEKPTPQERRFGILPNCCHAFCLGCIVTWRKTKDFQNEVVKSCPQCRVKSTF
YIPNKYWVREGEQKETLISSFKEKSRKIRCGFFTRHGSCPFKSECIYLHELPRGQRPRRL
RRSTPPYQVNLEDADSDSMHLLQYVITLALLDNDEDEEFLDD
Download sequence
Identical sequences W5LWJ1
ENSLOCP00000000498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]