SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000000790 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000000790
Domain Number 1 Region: 109-242
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 240-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000485
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 3 Region: 276-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000309
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 38-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000761
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000000790   Gene: ENSLOCG00000000683   Transcript: ENSLOCT00000000794
Sequence length 442
Comment pep:known_by_projection chromosome:LepOcu1:LG28:56201:60486:-1 gene:ENSLOCG00000000683 transcript:ENSLOCT00000000794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLWVVLLTCALHTAISQEPSESDAFTECTDGYQWDAQTLHCKDINECETIPDACKGEM
KCFNHYGGYLCLPRSASVIANNEVNAGAGDPSQSPASLPAAGHTPFNPCSLGYEPQGDTC
ADVDECEQDLHDCQPSQLCINTAGSFTCQCPDGYRKIGTECVDIDECRYRYCQHRCVNSP
GSFSCQCEPGFQLAGNNRSCVDVDECDMGAPCQQRCYNTYGTFACRCEQGYELGEDGFAC
NDIDECSYSSYLCQYRCVNEPGRFSCVCPEGYQLLGTRLCQDINECETGAHQCSESQTCV
NIHGGYQCVETNRCQEPYVQVSDNRCVCPVTKPGCRELPFSIVHRYMSITSDRSVPSDIF
QIQATSVYPGAYNTFRIRSGDEQGDFYIRQINNISAMLVLARAVTGPREFVLDLEMISVN
PLMSYQTSSALRLAVYVGPYAF
Download sequence
Identical sequences W5LXD3
ENSLOCP00000000790 XP_006642815.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]