SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000002171 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000002171
Domain Number 1 Region: 168-441
Classification Level Classification E-value
Superfamily Caspase-like 1.94e-86
Family Caspase catalytic domain 0.0000000353
Further Details:      
 
Domain Number 2 Region: 1-47
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000518
Family Caspase recruitment domain, CARD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000002171   Gene: ENSLOCG00000001860   Transcript: ENSLOCT00000002176
Sequence length 445
Comment pep:known_by_projection chromosome:LepOcu1:LG25:3556343:3570930:-1 gene:ENSLOCG00000001860 transcript:ENSLOCT00000002176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGRHKKILQSNRSMLVQQLDPSKLYDGLLSKGVFTQDMIDEIQSSGITVETCCLTKKNN
SLKGSSLILFGRFLNKQAEQTNKKMTRNGGNSTQRAQPCGRCCSHLYSYSFCHQELSHWR
STSTDKLGRDLSNQTHSPACLVNVINKGLSLALASQKDELDPKPQGRPRSNSLQVYKMDH
NPCGHCLIINNVDFERQSGLNNRTGSDIDCDRLEKRFKAFNFVVTVKRNLKSKQIRQELT
ALSKKDHSSYDCCVVVILSHGSEASHCRFPGAVHGVDGPIVAVQNITNYLNGQNCPTLQG
KPKLFFIQACGGDEKDTGFEVSEGFGPSSGGLDDQTDAMPMSSSSDSLSLTDEVDARASL
PTPSDILVSYSTFPGYVSWRDTAAGSWYVETLDNILAQNAKDEDLVTMLMMVTDKVSQIS
AKGIYKQMPGSFNFLRKRLFFQILP
Download sequence
Identical sequences W5M1B4
ENSLOCP00000002171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]