SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000002219 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000002219
Domain Number 1 Region: 668-933
Classification Level Classification E-value
Superfamily RNI-like 2.62e-53
Family 28-residue LRR 0.01
Further Details:      
 
Domain Number 2 Region: 20-94
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-16
Family Caspase recruitment domain, CARD 0.0059
Further Details:      
 
Domain Number 3 Region: 155-333
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000711
Family G proteins 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000002219   Gene: ENSLOCG00000001910   Transcript: ENSLOCT00000002224
Sequence length 944
Comment pep:known_by_projection chromosome:LepOcu1:LG11:2163919:2172651:-1 gene:ENSLOCG00000001910 transcript:ENSLOCT00000002224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMGTQDCSAAERPGNGVNTIRLLTVHRETLVSHIKNTQCILDNLLSSGFFCTEDAEIISR
FSTKTDQVRKILELVQSKGEEASQYFVHVLHEAYDAYIDLRPWFKEIQYQPSDSVKELPV
VNTDPVSKYCKKLRHELEQDTKFITSYAQKEETLLDEMYTDTVMELLNERNENLGHLDGL
EQLFSDWGVFNQLAETILVLGDAGVGKSILLQKLQNLWSTRQLNIQAKFFFKFRCRMFSA
FKETDEISLKDLLFKYNCYPDQDPDDEVFRYVLLHPETVLFTFDGFDEIHADIDTRNIPE
VCSPEEKTHPLLLLMNLLSGRLLKGCRKVLTARTGTEIQNKVVRKKVLLKGFSPESLRRY
TALHFQERDYQALVNTQLDANPHLCSLCSVPLFCWIIFKSFKHFQSIYDDFELPNIYITL
TNVFMLMAEVFLSRPSSPSLLKKSSRCQADTFRTGRETLMAFGKLANLGMEKTGFMFNHD
EVSSCGLTEKELQLGFLRPASHYDGSGNLSTFEFLHVTLQSFFAAFLLVQDENIGSVGIL
KFFTECEYRKTTHFCTCLGGSKPSTKDPFQDNEHLQFTNLFLCGLLSKSNVSLLEHLVSP
KSLKKKREVLKSYLSDSVKAHLKNVPRFKSEEEGSKIHVMPNFIWMLRCIYETQSEEIAK
LTASGISASHIKLTFCNIYSADCSALNFVLHHYKKHIGVDLDNNNVSDYGVKELKACFHK
LTVIRLSVNQITDCSMEVLAEELIKYKIIRVLGLYKNQLTDVGAKLVAQIIEECPSLRTV
KIGCNKITSKGGRYLADAIQKSRTIFEVGMWGNTIGDEGAKAFAEALKNHPSLTNLSLSA
NGISTEGGKSLAAALRENTSVHIFWLVQNEFNDEVAGCFAETVRVNAGLTHLWLIENKIT
AKGAKLLADALPQNGSLKEICLKANLLSKEEEAAFSHEPRLMFC
Download sequence
Identical sequences W5M1G1
ENSLOCP00000002219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]